KEGG   Bifidobacterium asteroides: BAST_0685Help
Entry
BAST_0685         CDS       T02271                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bast  Bifidobacterium asteroides
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAST_0685
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAST_0685
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BAST_0685
Enzymes [BR:bast01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BAST_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(930802..932283)
Genome map
AA seq 493 aa AA seqDB search
MSTYHSTRGDREQLQSKQAIRRGLAPDGGLYVSDGLDALTIDPATVAGLDYRGTAILVLS
GLLSDYSSAQLDSCLDAAYGEQWSDPAITPLVDLGGNDFVLELFRGPTSAFKDVALQLLP
RLMALAGEDGERIMVLTATSGDTGKAALAGFADAPGTGITVFYPQGKVSQIQRLQMVTQQ
GGNLQVCAVRGNFDDAQSAVKSIFADTDLARELEEKASTVLSSANSINVGRLAPQVVYYF
RAYGSLMERGVIRPGDPVEFCVPTGNFGDVLAGYYAKMMGLPVARLTVASDRNRVLNDFL
TTGVYDRNRPFYTTTSPSMDILISSNLERMLYYMADGDTKLIASLMADLESTGRYQVPDD
MMTRIRGLFSCGWADEDQVASAISDCWEDRGYLIDPHTACGYQVMTGQTDRDPAVPRVLL
STASPYKFPRVVCQSLGLETPDSDFDCMDILAESTNTRPPKALRTLENAPVRFQDCIDPG
DMSDYVRHAVIQS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcacataccacagcacccgaggcgacagggagcagctgcagtccaagcaggccatc
agacggggcctggcccctgacggcggactctacgtcagcgatggactggacgcactgacc
atcgaccctgccacggttgccggcctggactacaggggcacggccatactggtcctttcg
ggactgctgagcgattactcttccgctcagctggactcctgcctggacgcagcctacgga
gaacagtggtccgatccggcaataacccctctggtggacctgggcggcaacgacttcgta
ctggagctcttccgcgggcccacctcggccttcaaggatgtggccttgcagcttctgccg
agactgatggccctggccggggaggatggcgaacggatcatggtgctcaccgccacctcc
ggagacacgggcaaggcggcgctggccggattcgcagacgcgccgggcacgggcatcact
gttttctatcctcagggcaaggtcagtcagattcagcgcctgcagatggtcacccagcag
ggcggcaacctgcaggtctgtgcggttcggggcaatttcgacgatgcccagtccgcagtc
aagtccatcttcgccgacaccgatctggctcgtgaactggaggagaaggcctcgaccgtc
ctctcctcggccaactccatcaacgtgggccgcctggctccgcaggtcgtctactacttc
cgggcctacgggtccctgatggaacgaggggtgatcagacccggggatccggtcgaattc
tgcgtgcccaccggcaacttcggcgatgtgctggccggatactacgccaagatgatgggg
cttccggtggcccgcctgaccgtggcctcggaccgcaaccgggtcctcaacgatttcctg
accacaggcgtctatgaccgcaaccgccccttctacaccaccacctcccccagcatggac
atcctgatctcctccaacctggaacggatgctctactacatggccgacggcgacaccaaa
ctgattgcctcgcttatggccgatctggagtccacgggacgctatcaggtgcctgatgac
atgatgaccagaatccgcgggctcttctcctgcggctgggccgacgaggaccaggtggcc
tcagccatcagcgactgctgggaggaccggggatacctgatcgatccgcacacggcctgc
ggctaccaggtcatgaccgggcagaccgacagggatcctgccgtgccccgggtgctgctg
tccacagccagcccctacaagttcccccgggtggtctgccaatccctgggcctggagacc
ccggacagcgacttcgactgcatggacatcctggccgagtccaccaacaccaggcccccc
aaggctctgcgcaccctggaaaacgcacctgtacgcttccaggactgcatcgatccaggg
gacatgtccgactacgtccgccacgcggtcatacagtcctga

DBGET integrated database retrieval system