KEGG   Bifidobacterium asteroides: BAST_0730Help
Entry
BAST_0730         CDS       T02271                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bast  Bifidobacterium asteroides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAST_0730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAST_0730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAST_0730
Enzymes [BR:bast01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAST_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
982746..984851
Genome map
AA seq 701 aa AA seqDB search
MTVLDELVAGAVEDARGRVQKIPLESLKQQVRSMKRTPLDAARLLRESVGIPIIAEIKRA
SPSKGYLADIKNPAALARQYANGGASAISVLTEGRRFLGSLEDLRQVRQAVGIPVLNKNF
IVSDYQVWESRANGADMILLIVAALDDTRLKHLLALAGSLGMTALVETHDRQEIERAIAA
GARVIGINARNLKDLSVDVDQYARLASNLPKDVVKVAESGVFGTVELEQYARAGADAVLI
GEGLVTSQDQEGTVRLLVQAGHRFKAAEARPLSTHDGPYFGPYGGRFVPEALVGALDELE
RVYKEAKADPAFSEELNRLNRVYVGRPSALTPAPRFAKLISDRVGGQVRVFLKREDLNHT
GAHKINNALGQGLLVKRMGKSRVIAETGAGQHGVATATVCALLGFKCRIYMGQIDARRQA
LNVARMRMLGAEVVEVTTGTRILKDAINEALRDWVTNVESTHYLLGTVAGPHPFPTIVRD
FQKIIGEEASAQLSAYGIDHPDGVVACVGGGSNAIGIMNTFLDDPRVSLYAYEAGGNGPE
SGEHAIRLSPGTGQVGVFQGTKSYLLEDDQGQTMDTYSISAGLDYASVGPEHAWLHDMGR
VKYDYATDKEAMQAFSDLCRTEGIIPALESSHALAGASKAAADLLRKGIRNPVILINISG
RGDKDVATAGRRFGYLSEQEASALEAQAGHGKSGQTEEEAR
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcttggatgaactggtggccggcgccgtggaagatgctaggggccgggtacag
aagattcccttggaaagcctcaagcaacaggtcaggagcatgaagcgcacacccctggat
gccgcccgactgctcagggagagcgtcggcattccgatcatcgcagagatcaagcgcgcc
tcgccctccaaggggtatcttgccgacatcaaaaatcccgccgctctggcccggcagtat
gccaacgggggcgcctcggccatatccgtcctgaccgagggcagacgcttcctggggtcc
ttggaggatctgcggcaggtcaggcaggccgtgggcattcccgtgcttaacaagaatttc
atcgtctccgactaccaggtctgggagtccagggccaatggcgccgatatgatcctgctg
attgtcgcggccttggatgatacccgcctcaagcacctgctagccctggccgggagcctg
ggcatgaccgccctggtcgagactcatgatcgtcaggagatcgagcgggccatagcggcc
ggtgccagggtaatcggcattaacgcccggaacctgaaggacctgagcgttgacgttgac
cagtatgcccggctggcttccaacctgcccaaggacgtggtcaaggtggccgagtccgga
gtgttcgggacggtcgagctggagcagtacgcccgggcaggggccgatgcggtcctgata
ggggagggtctggtcacctcccaggaccaggagggtacggtccgcttgctggtccaggcc
ggtcaccgcttcaaggccgccgaggccaggcccctctcgacacatgacggtccctatttc
ggaccctatggcggacgtttcgtccccgaggccctggtgggcgcccttgacgagctggag
cgtgtctacaaggaggccaaggctgatccggccttcagcgaggagctgaacagactcaac
cgggtctatgtggggcgtccttcggccctgaccccggctcctcgcttcgccaagctgatc
agcgatcgggtcggcggccaggtcagggtcttcctgaagagggaggaccttaaccacacg
ggcgcccataagatcaacaatgccctgggccaagggctcctggtcaagcgcatgggcaag
agccgtgtcatagcggagaccggcgccgggcagcacggcgtggcaaccgctacggtctgt
gccctcctgggcttcaagtgccggatctacatggggcagatcgacgcgcgcaggcaggcc
ctgaacgtggccaggatgcgaatgctgggagctgaagtcgtcgaggtgaccaccgggacc
aggatcctcaaggatgccatcaacgaggccctgcgcgactgggtgaccaacgtggagtcc
acccactacctgctgggtacggtggccggcccccaccccttcccgaccatcgtcagggac
tttcagaagatcatcggcgaagaggcctccgctcaactgtctgcatatggcatcgaccat
cctgacggggttgtcgcctgcgtcggtggaggctccaacgccataggcatcatgaacacc
ttcctggacgatccccgggtctccctttacgcttacgaggccggcgggaacgggcccgag
tcgggcgagcacgccattcgcctgtcgccgggtacaggccaggtcggcgtcttccaggga
accaagtcctatctgttggaggacgaccagggccagaccatggacacctactccatctcc
gctggcctggactacgcctccgtgggacctgaacacgcctggctgcacgacatgggccgg
gtcaagtacgactatgcgaccgacaaggaggccatgcaggctttcagcgacctctgccgg
accgagggcatcatccctgccctggagtcctcgcacgccttggccggagccagcaaggcg
gccgccgaccttttgcgcaagggaatcaggaatcctgtcattctgatcaacatctcgggc
aggggcgacaaggatgtggccacggcgggcagacggttcggttacctgtccgagcaggag
gccagcgctctggaagcccaggccgggcacggaaagagcggtcaaacagaagaggaggcc
cgctga

DBGET integrated database retrieval system