KEGG   Bifidobacterium asteroides: BAST_0731Help
Entry
BAST_0731         CDS       T02271                                 

Definition
tryptophan synthase, alpha subunit (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bast  Bifidobacterium asteroides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAST_0731
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAST_0731
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAST_0731
Enzymes [BR:bast01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAST_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
984851..985741
Genome map
AA seq 296 aa AA seqDB search
MVNQQWQWQKAPAQPVQPKGFSSAASPVASTLQALRQQGRPAFIGYFPYGFPDVPTSLEA
MRVMVKNGVDIVEIGLPYSDPVMDGPVIQAASKCAIDNGVKVEGVFDAVRQVQADGARAL
VMSYWNLILHHGVADFAQRMAEAGGSGLVTPDLIVDESGEWIEQSDRYGLDRVYLVSPDS
TDARLQLTSRAARGFVYATSRMGVTGERTSMSNSAQNLVARVRHAGAPYVCVGIGVSTAQ
QASQVGAYADGVIVGSALVHCLLDDEGRPRKDRRKALEALAEVCSDLRWGISQARK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccagcaatggcaatggcagaaagcccccgcccagcccgtccagcccaagggg
ttcagctctgcggccagcccggtggcatccacgctgcaggccctccgccagcaaggcaga
cccgctttcatcggctacttcccctatggattccccgacgtgcccacatccctggaggcc
atgcgggtcatggtgaaaaacggggtcgacatcgtcgagatcggactgccctacagcgac
ccggtcatggatggcccggtcatccaggcggccagcaagtgcgccatcgacaatggtgtc
aaggtcgaaggcgtcttcgatgcggtccgacaggtccaggcggacggtgcaagggctctg
gtcatgagctactggaatctgattctgcaccatggggtagcggactttgctcaacgcatg
gccgaagccggaggatccgggctggtcaccccggatctgatcgtcgacgaatccggggaa
tggatagagcagtcggaccgctatggcctcgaccgggtctatctggtctcgcccgactcc
accgatgcacgtctgcagctcacctcccgagctgccagaggcttcgtctacgcgacatcc
cggatgggtgtgaccggagagcgaaccagcatgtccaactcggcccagaacctggtggcg
agagtcaggcatgcgggcgctccttatgtgtgcgtgggcatcggggtttcgaccgcccag
caggcctcccaggtcggcgcatacgcggacggggtcatcgtcggatcggccctggttcac
tgtcttctggatgacgagggcaggccgcggaaggaccgcagaaaggcactggaggccttg
gctgaggtttgctctgatctgcgttggggcatctcccaggccaggaagtga

DBGET integrated database retrieval system