KEGG   Bifidobacterium asteroides: BAST_0731Help
Entry
BAST_0731         CDS       T02271                                 

Definition
tryptophan synthase, alpha subunit (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bast  Bifidobacterium asteroides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bast01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bast00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bast00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
984851..985741
Genome map
AA seq 296 aa AA seqDB search
MVNQQWQWQKAPAQPVQPKGFSSAASPVASTLQALRQQGRPAFIGYFPYGFPDVPTSLEA
MRVMVKNGVDIVEIGLPYSDPVMDGPVIQAASKCAIDNGVKVEGVFDAVRQVQADGARAL
VMSYWNLILHHGVADFAQRMAEAGGSGLVTPDLIVDESGEWIEQSDRYGLDRVYLVSPDS
TDARLQLTSRAARGFVYATSRMGVTGERTSMSNSAQNLVARVRHAGAPYVCVGIGVSTAQ
QASQVGAYADGVIVGSALVHCLLDDEGRPRKDRRKALEALAEVCSDLRWGISQARK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccagcaatggcaatggcagaaagcccccgcccagcccgtccagcccaagggg
ttcagctctgcggccagcccggtggcatccacgctgcaggccctccgccagcaaggcaga
cccgctttcatcggctacttcccctatggattccccgacgtgcccacatccctggaggcc
atgcgggtcatggtgaaaaacggggtcgacatcgtcgagatcggactgccctacagcgac
ccggtcatggatggcccggtcatccaggcggccagcaagtgcgccatcgacaatggtgtc
aaggtcgaaggcgtcttcgatgcggtccgacaggtccaggcggacggtgcaagggctctg
gtcatgagctactggaatctgattctgcaccatggggtagcggactttgctcaacgcatg
gccgaagccggaggatccgggctggtcaccccggatctgatcgtcgacgaatccggggaa
tggatagagcagtcggaccgctatggcctcgaccgggtctatctggtctcgcccgactcc
accgatgcacgtctgcagctcacctcccgagctgccagaggcttcgtctacgcgacatcc
cggatgggtgtgaccggagagcgaaccagcatgtccaactcggcccagaacctggtggcg
agagtcaggcatgcgggcgctccttatgtgtgcgtgggcatcggggtttcgaccgcccag
caggcctcccaggtcggcgcatacgcggacggggtcatcgtcggatcggccctggttcac
tgtcttctggatgacgagggcaggccgcggaaggaccgcagaaaggcactggaggccttg
gctgaggtttgctctgatctgcgttggggcatctcccaggccaggaagtga

DBGET integrated database retrieval system