KEGG   Bifidobacterium asteroides: BAST_0747Help
Entry
BAST_0747         CDS       T02271                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bast  Bifidobacterium asteroides
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bast00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bast00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bast00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bast00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(998892..1000322)
Genome map
AA seq 476 aa AA seqDB search
MSTDVFDLSAAKMRDKGMSEVSINQFKHLYETWERGDAKACVREKDVTPLKDVPRTKDIH
DAMDMDMALDAFSRTAFIKLNGGLGTSMGLEKAKSLLPIRRHKARRMRFLDIIMGQVLTA
RKRLGVPLPLIFMNSFRTSRDTMRVVKQDRRFVQNDVPMEIIQHIEPKIDADTGRPVDFP
AKPDLEWCPPGHGDIFSTIWETGLLDILKEQGIDYLFISNSDNLGARPSRTLAGYFAQSG
APFMIEVAKRTEADRKGGHIVIDKASGRLILREMSQVDPHDRSSAMSIRKHPYFNTNSIW
VRVDALRDKLAQYDGVLPLPIIENRKTVDPTDPSTPPVVQLETAMGSAASLFDGAICVQV
DRMRFLPVKTTDDLFIMRSDRFHLTDSYEMEDGNYDFPNVQLDERYYKYIADFDERFPYG
VPSLAAANSVTIEGDWTFGRDVTLYADAHLSDQGRSSYVPNGQYVGPQGIEPDEWV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagacgttttcgacctttcggccgcgaagatgcgagacaagggcatgagcgaa
gtctccatcaaccagttcaagcacctctacgaaacctgggaacggggagatgccaaggcc
tgcgtgcgcgagaaggacgtcaccccgctcaaggacgtgccccgcaccaaggacatccac
gacgccatggacatggacatggcactggacgcattctcccgcaccgccttcatcaaactc
aacggagggctgggcacctccatgggcctggaaaaggccaagtccctgctgcccatccgt
cgccacaaggcccgtcggatgcgctttctggacatcatcatgggccaggtactgactgcc
cgcaagcgcctgggggtgccgctgccgcttatcttcatgaactccttccgaacctcgcgt
gacaccatgcgcgtagtcaagcaggatcgccgtttcgtccagaacgacgtgcccatggag
atcattcagcacatcgaacccaagatcgatgccgacaccggccgtccggtcgacttccca
gccaagcccgatttggaatggtgccctcccggccacggcgacatcttctcgaccatctgg
gagaccggtctgctggacatacttaaggaacagggaatcgactacctgttcatctccaac
tccgacaaccttggcgccaggccttcaaggaccctggccggctatttcgcacagtccgga
gcgcccttcatgatcgaggtggccaagcggaccgaggctgaccgcaagggcggccacatc
gtcatcgacaaggccagcggacgcctcatcctacgggagatgtcacaggtggacccgcat
gaccgcagctcggccatgtccatccgcaagcatccctacttcaacaccaacagcatctgg
gtcagggtcgatgccctacgcgacaagcttgcccaatatgacggcgtgctgccccttccc
atcatcgagaaccgtaagaccgtcgatcccaccgatccttccacccctcccgtagtgcaa
ctggagaccgccatgggctcagccgcttcgctcttcgacggggccatctgcgtccaggtg
gaccgtatgcgcttcctgcccgtcaagaccaccgacgacctgttcatcatgcgctccgac
cgcttccatctgaccgactcctacgagatggaggatggcaactacgatttcccaaatgtc
cagctggatgagcgctactacaagtacatcgccgacttcgacgaacgcttcccctacggg
gttcccagcctggcggctgccaactcggtcaccatcgagggggactggaccttcggcagg
gatgtgaccttgtatgcggacgcccacctgagcgaccagggacgctcctcatacgtgccc
aacggtcagtatgtgggaccccaggggatcgaaccggacgagtgggtctag

DBGET integrated database retrieval system