KEGG   Bifidobacterium asteroides: BAST_0789Help
Entry
BAST_0789         CDS       T02271                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00020  Citrate cycle (TCA cycle)
bast00640  Propanoate metabolism
bast00660  C5-Branched dibasic acid metabolism
bast01100  Metabolic pathways
bast01110  Biosynthesis of secondary metabolites
bast01120  Microbial metabolism in diverse environments
bast01130  Biosynthesis of antibiotics
bast01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAST_0789
   00640 Propanoate metabolism
    BAST_0789
   00660 C5-Branched dibasic acid metabolism
    BAST_0789
Enzymes [BR:bast01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BAST_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFU71373
UniProt: K4INJ5
Position
complement(1047118..1048332)
Genome map
AA seq 404 aa AA seqDB search
MDLYEYQARQLLAEHGISQPRAVYASTAEEAGQAADVIGYPCMIKGQATIGHRGQAGAVK
RAENHDQAVALAEAILPMNIDGHPVSGILVTEARNILHEYYLSISVDRTSRDYDVLATAS
GGTEVETIAREHPESVRRLHIGPLEDFDRQAARTMAERIGFYHADLEQAAQILLGMWHTF
QDSDATLVEINPLAKVGDPDDEATKHLDALDAKISLDGNAAFRHDGWKRFADPAQLDPLE
AKAKASGLHYVHLDGQVGVIGNGAGLVMSSLDAVAGSGRRQGVPVGPANFLDIGGGASPE
VMRTSLDVVLSDPKVRSVMVNVYGGITSCQQVAQGILAAVNAAGEQDQNDDRPIVVRFDG
NEAAEGLDLLAKAQQPRLRVARTMEEAADQAVALAAGVGKETGR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggatttgtacgaataccaggccaggcagctgctcgctgaacatggcatctcccaaccc
agggccgtctatgcctcaaccgcagaagaggccggccaggcagccgacgtcatcggctac
ccatgcatgatcaagggccaggccaccattggccataggggacaggccggagccgtcaag
cgagccgagaatcacgatcaggccgtagccttggccgaagccattctgcccatgaacatc
gacggccatccggtcagcggtattctggtcaccgaggcccgcaacatcctgcacgaatac
tacctgtccatttctgtggaccgcacctcacgggactatgacgttttggccacggccagc
ggcggcaccgaggtcgagaccatcgcccgagaacaccccgaatcggtccggcgcctgcac
ataggccccctggaggatttcgacaggcaggcagcccgtaccatggccgagcgcatcggc
ttctaccacgcagacctggagcaggccgcgcagattcttctgggcatgtggcacaccttc
caggacagcgatgcaaccctggtcgaaatcaaccctctggccaaggtgggtgatccggac
gacgaggccaccaagcacctggatgcccttgatgccaagatctccctggacgggaacgcg
gccttccggcacgacggctggaagcggttcgcggacccggctcagttggacccgctggaa
gccaaggccaaggcctcgggcctgcattacgttcacttggacggccaggtgggcgtcatc
ggcaacggcgcaggactggtcatgagctccttggatgcggtcgccgggtcgggacgacga
cagggcgtgcccgtgggaccggccaacttcctggacatcggcggcggagcctcgcccgag
gtcatgcgcaccagtctggacgtggtcctttctgaccccaaggtccgttcggtcatggtc
aatgtctatggaggcatcacctcctgccagcaggtggcccagggcatcctggccgccgtg
aacgctgcgggagagcaagaccagaacgacgaccggcccatcgtggtccgcttcgacggc
aatgaggccgccgaagggctggacctgctggccaaggcccaacagcctcggctcagggtg
gcccggaccatggaggaggcggcagaccaggctgtggccctggccgctggagtgggaaag
gagacgggcagatga

DBGET integrated database retrieval system