KEGG   Bifidobacterium asteroides: BAST_0793Help
Entry
BAST_0793         CDS       T02271                                 

Definition
Holliday junction DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bast  Bifidobacterium asteroides
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bast00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAST_0793
Enzymes [BR:bast01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BAST_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1050809..1051420)
Genome map
AA seq 203 aa AA seqDB search
MLAMLTGRVAAIETGSAVIDVSGVGFEVRMPQSDLASMRAESTVTVYTVLSMTQDALTLY
GFLSRTSKSLFAQLQKVSGIGPRVALSILSTLNSDQLAQAVADGDAAALSRAPGLGKKGA
QKIILELSGKLDLDAGKGRQGPAQTDDGAHQVVEGLISLGWLQRDAEQAVEQTCKEGDYT
LPLQSADIPKVLKQALTRLDRGR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcaatgctgactgggcgggtggccgccatcgaaacgggctctgctgtcatcgat
gtttcgggagtgggtttcgaggtgcgtatgccccagtcggacttggcctccatgcgggcc
gaatccacagtcaccgtctacacagtcctgtccatgacccaggatgcgctgaccctctac
gggtttctcagccgcacatccaaatccctcttcgcccagctgcagaaggtcagcggcatc
ggaccccgagtggccctgtccatcctctctaccctgaactcggaccagctggcccaggcc
gtggctgacggcgatgctgcggccctgtcccgggcaccgggtctaggcaagaaaggcgct
cagaaaatcatcctcgaactctccggcaagctggatctggatgccggcaaaggccgacag
ggacccgcccagacggacgacggcgcccaccaggtggttgagggactgatttccctgggc
tggctgcagcgcgatgccgaacaggccgtggagcagacctgcaaagagggcgactacacc
ctgcccctgcagtcggccgacattcccaaggtgctcaagcaggctctgacccggctggac
agggggcgctga

DBGET integrated database retrieval system