KEGG   Bifidobacterium asteroides: BAST_0813Help
Entry
BAST_0813         CDS       T02271                                 

Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bast  Bifidobacterium asteroides
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAST_0813
   01230 Biosynthesis of amino acids
    BAST_0813
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAST_0813
   00051 Fructose and mannose metabolism
    BAST_0813
   00562 Inositol phosphate metabolism
    BAST_0813
Enzymes [BR:bast01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAST_0813
Exosome [BR:bast04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAST_0813
  Exosomal proteins of bladder cancer cells
   BAST_0813
  Exosomal proteins of melanoma cells
   BAST_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1076412..1077194)
Genome map
AA seq 260 aa AA seqDB search
MARIPLVAGNWKMNFDHLEATYFVQKLAWLLRDAHFDRRRCRVALMPAFTALRSVQVLVE
ADNLPIEYGAQAVSVTAQGAFTGDVSADMLAQLGCSYVIVGHSERRKYHPEDDANIVDQV
RAVLAADMKPILCVGESYEERRQGIQLDFAVGQVNDVTRDLAKEDMANLIVAYEPVWAIG
TGMVATPDTAQQAARAIRDHISNKFGEPAGQAVRILYGGSVTSKNASQMITQPDVDGFLV
GGASLDVEEFSRIVRLAAKG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcattcccttggtggccggcaattggaagatgaacttcgaccacctggaagcc
acctatttcgtacagaagctggcttggctcctgcgcgacgcccacttcgaccgcaggcgc
tgccgggtggctctgatgcccgccttcaccgccctgcgttccgtccaggtgctggtggag
gccgacaatctgcccatcgaatacggggcacaggccgtctcggtcaccgctcaaggggcc
tttacgggggacgtgtccgccgacatgctggctcagctgggctgcagctacgtcatcgta
ggccattccgagcggcgcaagtaccatccggaggatgatgccaacatcgtcgaccaggtc
cgggccgtcctggctgcggacatgaagcccatcctctgcgtgggggagagctacgaggag
cgccgccagggcatacagctggacttcgctgtagggcaggtcaatgacgtcacccgagac
ctggccaaggaggacatggccaacctgatcgtggcctacgaaccggtatgggccatcggt
accggcatggtcgctactcccgacaccgcccagcaggccgccagggccatccgcgaccac
atctcaaacaagttcggggagccagccggccaggccgtgcgcatcctctacggcggctcg
gtcacctccaagaacgcctcccagatgatcacccagccggacgttgacggcttcctggtg
ggtggggcctccctggatgtggaggaattctcgcgaatcgtgcgactggccgccaagggc
tga

DBGET integrated database retrieval system