KEGG   Bifidobacterium asteroides: BAST_0834Help
Entry
BAST_0834         CDS       T02271                                 

Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bast  Bifidobacterium asteroides
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bast00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bast00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1101934..1102968)
Genome map
AA seq 344 aa AA seqDB search
MSQQVDHASNTSSAVDSRSGPANTVPLRGRSVVTLDDIPMTQILDLLDRAAYIDTHRRQV
AHTCDGRVLATLFYEPSTRTRLSFETAMLRLGGQVIGFAGAQLASVSKGESISDTLKTVS
NYADIVAIRHPKEGAALVASKAATVPVINAGDGGHMHPTQTLTDLATIRARKGRLNHLAI
GLCGDLTFGRTVHSLITTLCRLGHVDFVLISPDELRTPEYVLERIRSSADCTYRETGDLN
GVIGDLDVLYMTRVQQERFFNEDDYLRLRDTYILNADKLRAARPDMAILHPLPRVNEIAV
EVDDDPRAAYFQQVRNGMLVRMALESALLGDELPGYRERKEVAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccaacaagttgatcacgcatccaacacctcttccgccgtcgattctcgttccggc
cccgcaaataccgttccgcttcgtgggcgaagtgtggtgaccctcgacgacattcccatg
acccagatcctggacctgctggatcgtgcggcctacatcgacacccaccgccgccaggtg
gcccacacctgcgacggccgggtcctggccacgctcttctatgaacccagcacccgcacc
cggctcagcttcgagacggccatgctccgtctgggcggccaggtcatcgggttcgccggc
gcccagctggccagcgtctccaagggtgagtccatcagcgacaccctgaagaccgtctcc
aactacgccgacatcgtggccatccggcaccccaaggagggtgccgccctggtggcatcc
aaggcagccacggtcccggtcatcaacgccggcgacggcggacacatgcacccgacccag
accctgaccgacctggccaccatccgcgcccgcaagggtcggctgaaccacctggccatc
ggcctgtgcggggatctgaccttcggccgcaccgtccactccctgatcaccaccctctgc
cgcctgggccacgtggacttcgtcctgatcagtcccgacgagctgcgcaccccggaatac
gtcctggagaggatccgctcctcggccgactgcacctaccgggagaccggggacctgaac
ggggtcatcggcgacctggatgtgctctacatgacccgtgtccagcaggagcgcttcttc
aacgaggacgactacctgcgtctgcgcgacacctacattctgaatgccgacaagcttagg
gctgcgcgccccgacatggccatcctccaccccctgcccagggtcaatgagatcgccgtg
gaggtggacgatgatccgcgtgcggcctacttccagcaggttcgcaacggcatgctggtc
agaatggccctggagagcgccctgctgggtgacgagctgcccggttaccgcgagcggaag
gaggtggcggcatga

DBGET integrated database retrieval system