KEGG   Bifidobacterium asteroides: BAST_1141Help
Entry
BAST_1141         CDS       T02271                                 

Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bast  Bifidobacterium asteroides
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAST_1141
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAST_1141
  Lipid metabolism
   00071 Fatty acid degradation
    BAST_1141
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAST_1141
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAST_1141
   00626 Naphthalene degradation
    BAST_1141
Enzymes [BR:bast01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAST_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484167..1485216
Genome map
AA seq 349 aa AA seqDB search
MKAVVFEEFNTFPTLKEVPEPTPGSGEVLLKVAGAGCCHSDVSVFQDYTPETGSHTKPPF
ILGHETTGWVEEVGPDVTGFKKGDAYIVYGPTGCGHCPHCVAGQENYCSSAATNKSLALG
LGRDGGMAEYMTVPARNLVPLGDADPIGAAPLADAALTPYHAIRAAMPHLNGGGKYALVI
GLGGLGQIAIQILHALTGATVIATDTKPEALAKAEAKGAIPVVSDEHQVENIRKITHGEG
VDAAFDFVGVAPTIAAAQASGGPGSRVTVVGIAGGKAEYDWYSKPWEQELLGVYWGSIPE
LYDVANMYRNGQIETEIETYSLDNALDAYHKLVDNKLSARAVIVPHTKA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttgttttcgaagaattcaacaccttccccaccctcaaggaagtgccggag
ccgactcccgggagcggcgaggttctcctcaaggtggctggtgcaggttgctgccattcc
gacgtctccgtcttccaggactacacccccgaaaccggcagccacaccaagccgcccttc
attctggggcatgagaccactggttgggtcgaagaggtaggacccgatgtcacgggcttc
aagaagggcgatgcctacatcgtctatggtcccaccggatgcggccactgccctcactgc
gtagccggccaggagaactactgctccagcgctgcaaccaataaatcactggccctgggt
ctgggtcgcgacggcggcatggccgaatacatgaccgtcccagcccgcaacctggtgccc
ctgggcgatgcggatcctatcggcgcagcacccctggctgacgctgcgctgaccccatac
cacgccatcagggctgccatgccccacctgaacggcggcggaaagtacgctctggtcatt
ggcctgggtggacttggccagatcgccattcagattcttcacgccctgaccggcgccacc
gtgatcgccaccgataccaagccagaggccctggccaaggctgaggccaagggtgccatc
cccgtggtcagcgacgagcatcaggtggagaacatcaggaagatcacccacggggagggc
gtggacgccgccttcgatttcgtgggtgtggccccgaccattgctgccgcacaggcttcg
ggcggcccgggatcccgggtgaccgtggtcggcatcgccggcggcaaggcggaatacgac
tggtactccaagccctgggagcaggagctgcttggtgtttactggggttccatccctgag
ctctacgatgtggccaacatgtatcgcaacggccagatcgagaccgagatcgaaacctac
tcactggataatgccctggatgcctaccacaagctggtcgacaacaagctctcggccagg
gctgttatagtgccccacaccaaggcctga

DBGET integrated database retrieval system