KEGG   Bifidobacterium asteroides: BAST_1202Help
Entry
BAST_1202         CDS       T02271                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bast  Bifidobacterium asteroides
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bast00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1556960..1559062)
Genome map
AA seq 700 aa AA seqDB search
MSKPTRRAYRWPKHLKGQQSLWYGCDYNPDQWPEDVWDEDIRLMTKAGVNVVALAVFSWS
RIEPSQGVFDFDWLDRIIDKLGRAGIGVNLASATASPPLWLTQAHPEVLLRDERGDTVWP
GARQHWRPTSPVFRSYALKLCRAMAEHYRDNPYLVAWHVGNEYGCHNRFDYSDDAMRAFQ
RWCRRRYKDIEAVNLAWGTNFWSQRLSDFSQILPPRFIGQGNFQNPGRMLDFERFSSDAL
KDFYMAERDTLAEITPDIPLTTNFMVSAGGFALDYDDWGDQVDFVANDHYATPGRNHLEE
LAYSSSLVDAIARRRPWWLMEQSTSAVNWRPVNPRKEPGQLERDSLAHLALGADAICYFQ
WRQSRAGAEKFHSAMLPHAGEDTAVFRDVCQLGVDLQGLSQAGLAGSTLAKAPLALVFDY
ASQWASSHASSPSDRVEHGQEPPVWYRAFLDNAIRPDVLPVRATWEEYPLVVLPALYLID
ADLSKRLHKYVHSGGRLIVTWGSGIADEQDRVWTGGYPGPLRDLLGLSVEEFAPMAPGTP
GLLDHLDLTNGVTAHDWADVIGHLDKGAKVLASYRADPWTGMDGMPAMTVHNWGLGKAAY
LGCRLDARGLAKVIPVLLEALDVAEMRSAQGDSDLLRVERVSQDDRTRFVFLFNRTKHPV
QVQLEGQVLVGSLASIDGDGKQASLQVNGALVQRVVGRRH
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaccgacacggcgggcctatcgatggcccaagcatctcaagggtcagcagtcc
ctctggtacggatgcgactacaaccccgatcagtggcccgaggatgtatgggatgaggac
atcaggctgatgaccaaggcaggggtcaacgtggtggccctggcggtcttctcctggtcg
cgcatcgagcccagccagggtgttttcgacttcgactggctggaccggatcattgacaag
cttggtcgggccggcatcggggtcaatctggcctcggccacagcctcgccgccgctgtgg
ctgacccaggcccatcctgaggttctgctcagggacgagcgtggcgacacggtctggccc
ggggctcgtcagcactggcgacccacctcgccggtcttccgctcctacgccttgaagctg
tgccgggccatggccgagcactaccgggacaacccctatctggtggcctggcatgtgggc
aacgagtatggctgtcacaatcgcttcgactattccgacgatgcgatgagggccttccag
cgctggtgccgccgccgctataaggacatcgaggccgtcaacctcgcctggggcacgaat
ttctggtcgcagaggctgagcgacttctcgcagattctgccgccgcgttttatcggccag
gggaatttccagaatccgggacgcatgctggacttcgagcggttcagctccgatgccctc
aaggatttctatatggccgagcgtgacaccttggctgagatcaccccggatatacctttg
accaccaacttcatggtcagcgccggcggattcgccctggactacgacgactggggcgac
caggtggactttgtggccaatgaccactatgcgacgccgggcaggaatcatctggaggag
ctggcctattcctccagcctggtggatgccatcgcccgtaggcgcccctggtggctcatg
gagcagtccacgtcggcggtcaactggcggccggtcaacccccgcaaggagcccggacag
ctggagcgcgattccctggctcatctggccctgggtgctgatgccatctgctacttccag
tggaggcagtcccgggctggcgcggaaaagttccactcggccatgctccctcatgccggc
gaggacacggccgtcttccgtgacgtctgccagctgggagtggacttgcaggggctctcg
caggccggtctggcgggtagtacgctggccaaggccccgctggccctggtcttcgactac
gcaagccagtgggccagctcccacgcgtcctcgcccagcgaccgggtcgaacatggccag
gagccgccggtctggtaccgggcctttctggacaacgccatccggcctgatgtcctgccg
gtcagggctacctgggaggagtacccgctggtggttctgccggccctatacctgattgac
gccgatctctccaagcgactgcacaagtatgtacatagtggagggcggctgatcgtcacc
tggggcagcggtatcgccgacgagcaggaccgggtctggaccggcgggtatccggggccg
cttcgggacctgttggggctgtcggtcgaggagttcgcacccatggctcccggcacgccc
ggtctgctggaccatctggacctgaccaacggggtcacggcccacgactgggccgatgtc
atcgggcacctggacaagggcgccaaggtcctggcaagctaccgggcggatccctggacg
gggatggatggcatgccggccatgaccgttcataactggggtcttggcaaggccgcctac
ctgggctgccgactggatgcccgaggtctggccaaggttattcctgtcctgctggaggcc
ctggatgtcgcagaaatgaggtcggcccagggtgattccgatctgttgagagtcgagcga
gtcagccaggatgatcggacgcgcttcgtctttctgttcaacaggaccaagcatccggtg
caggttcagctggagggccaggttctggtgggctcactggccagcatcgacggggatggc
aaacaggccagtctgcaggtcaatggcgccctggtgcagcgtgtggtcggccgtcggcat
tga

DBGET integrated database retrieval system