KEGG   Bifidobacterium asteroides: BAST_1242Help
Entry
BAST_1242         CDS       T02271                                 

Definition
putative aldolase-pyrophosphokinase (EC:4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bast  Bifidobacterium asteroides
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bast00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1604683..1605765)
Genome map
AA seq 360 aa AA seqDB search
MDSIHLSSIKVAPLHDQQKPGFSYQVDAVLYLDLSEAGRLNDGTQTVDYVQIVRRIVNLI
QNEPAYEILESLTAKVADAILLSHQIRRTRVTVTRLGADQGTGVDFQVGVTLERAADDQV
QGNPGSLESGRVSSAGNAPLGHPSLLLSGQADSGHAAQARLRHPVTSSTQNGLSSDPESG
NEAFSHPTVEGGQPQGLLMRDVIALEGASGTDRLTMLRALAALDGIPGSQLVGISPLYAY
RDDQGDQRLSAVVILQTPLNLKELRSALDMVAAPIRQMGKLDADVVEVETLDGSVLSSQD
RPPLLAADAPSRILIPWAYLDPEHCLSGADGSCLASLANRAPDRDRISLVSEDWILDGLS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggattccatccatttgagctccatcaaggttgcacccctgcacgaccagcagaagcct
gggttcagctaccaggtcgatgccgttctctatctggatttgagtgaggcaggcaggctc
aacgacggcactcagaccgtggactatgtgcagatcgtccgtcggatcgtcaacctgatt
caaaacgaaccggcttatgagattctggaatctctgaccgccaaggtggctgatgccatc
ctgctctcccaccagattcgccgtacaagggttacagtcacccgtctgggcgctgaccag
ggtacaggagtcgattttcaggtgggcgtcaccttggagcgggccgccgacgaccaggtg
cagggcaaccccggcagtttggagtccggacgagtcagcagtgccgggaatgcccctcta
gggcatccctccctcctgttgtctggccaggccgattctggacatgcggcgcaggcgcga
ctgcgtcaccccgtgacctcttctacgcagaacggcctatcctcagatccggagagtggt
aacgaagcgttcagtcatccgactgttgaaggaggacaaccgcaaggcctcctgatgcgt
gatgtaatcgcgttggagggggcatcgggaaccgaccggttgaccatgctccgtgctctt
gccgccttggacggaatccctggcagccagcttgttggcatctcgcccctgtatgcctac
cgggacgatcagggggatcagcgtctatctgccgtggttatcctgcagacgccgctgaat
ctgaaggagctgcggtcggccctggacatggtggccgccccaatcagacagatgggtaaa
ttggatgccgatgtggttgaggtggagaccttggacggttcggttctgtcctcccaggac
cgtccgcctctgctggctgctgacgctccatcgcgcattttgattccctgggcttatttg
gatcctgaacactgcctgtctggagctgatggatcctgtcttgcaagcttggccaaccgt
gctcctgaccgagatcgcatcagcctggtctcggaggactggattttggacggtctgtca
tga

DBGET integrated database retrieval system