KEGG   Bifidobacterium asteroides: BAST_1396Help
Entry
BAST_1396         CDS       T02271                                 

Definition
O-glycosyl hydrolase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bast  Bifidobacterium asteroides
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bast00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bast00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1770994..1772529)
Genome map
AA seq 511 aa AA seqDB search
MKEIWTATAGDLSQRREPIATPETTTGPGAAVPIVIDPTRRYQYWEGAGAALTDSSAYLF
MTAMDADQRHRILTELFDPAQAGLSTLRISIGSCDFSSQRYYSYDELPEGVMSDSDMTYF
SIGQGKPGSPEATKDMKYVVPVLQEIMAINPGVRIMASPWSAPAWMKDSGQLEGAGRLRL
GQYCGNGYRPRDTVDAAYARYFIRFIQAYQELGIPIASVTMQNEPSNNPSWPMTTWTPEE
LVRWGVDYLRPALDRSFPEVEIFFGDDGLRFFSRPVSDYMTPAEAQSFAGTAMHTYSGLP
KWVVNATRQFPGWRSVMSERRCMLDEQVDEASHVMFGEIGIGLVRQGVGMIDLWNLALDE
RGLPSWARTMGRRGVITVDSQTGGVKRNLEYFMLRNFGQDVPVGARRVASTSHTGDGRTG
GLGSVAFIRDDGELSVILYNPTKEPIRAALTVNGWGASWRPVSVPAFGTVSCHISGSDRL
NCSTVPEDDQFVVHMTPHPADDHYEGEDDQA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagatttggaccgcaacggcaggggacctgtcccagcggcgagaacctatagcg
accccggagacgacaactgggcccggcgcggccgtccccatcgtcattgatccaaccaga
cgctatcagtactgggagggggccggcgctgctctgacggactccagtgcctacctgttc
atgacggccatggatgctgaccaacgtcatcggattctgactgagctcttcgatccggct
caggcgggcctatccaccttgaggatctccatcgggtcctgcgatttctccagccagcgt
tactactcctatgatgagctgcccgagggcgtgatgtcggattcggatatgacatacttc
tccattgggcaggggaagccgggctcgcccgaggccaccaaggacatgaagtacgtggtc
cccgtccttcaggagatcatggccatcaacccgggcgtacggattatggcttcgccctgg
agcgcgcctgcctggatgaaggacagcggtcagctggagggtgctgggcgtctacggttg
gggcaatactgtggcaacggctaccgcccgcgggatacggtagacgctgcctatgcccgc
tatttcatccggtttatccaggcttaccaggagcttggcattcccattgcgtccgtcacc
atgcagaacgagccctccaacaatccttcctggcctatgacgacctggacccccgaagag
ctggtgcgctggggggtggactacctgcgtccggcactcgatcgcagcttccctgaggtg
gagatcttcttcggcgatgacggcctgagattcttcagccgtccggtcagcgactatatg
acccctgccgaggcccagagcttcgccgggacggccatgcatacatattccggcctgccc
aaatgggtcgtgaacgccaccaggcagttccccggatggcgttcggtcatgagtgagcgg
cgctgcatgctggacgagcaggtggacgaggccagccatgtcatgttcggggagataggc
atcggacttgtccgtcagggcgtgggcatgatcgacctgtggaatctggccctggatgag
cggggtctgcccagctgggcgagaaccatgggccggcgcggggtcatcaccgtcgattcc
caaactggcggagtcaagcgaaacctggaatatttcatgctccgtaatttcggacaggat
gtgccggtcggcgctcgcagggtggcctccaccagccataccggtgacggtcggaccggt
ggtctgggatcggtcgccttcatccgcgacgacggcgagctcagcgttatcctctataat
ccgaccaaagaacccatccgtgcggccctgaccgtcaatggctggggcgcaagctggcga
ccggtaagcgtacctgctttcgggacggtctcctgccatatctcaggctccgatcgcctc
aactgcagcacggtgcccgaggatgaccaattcgtcgtccatatgactccgcacccagct
gacgaccattacgagggggaggacgaccaggcctga

DBGET integrated database retrieval system