KEGG   Bifidobacterium asteroides: BAST_1396Help
Entry
BAST_1396         CDS       T02271                                 

Definition
O-glycosyl hydrolase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bast  Bifidobacterium asteroides
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BAST_1396
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BAST_1396
Enzymes [BR:bast01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BAST_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1770994..1772529)
Genome map
AA seq 511 aa AA seqDB search
MKEIWTATAGDLSQRREPIATPETTTGPGAAVPIVIDPTRRYQYWEGAGAALTDSSAYLF
MTAMDADQRHRILTELFDPAQAGLSTLRISIGSCDFSSQRYYSYDELPEGVMSDSDMTYF
SIGQGKPGSPEATKDMKYVVPVLQEIMAINPGVRIMASPWSAPAWMKDSGQLEGAGRLRL
GQYCGNGYRPRDTVDAAYARYFIRFIQAYQELGIPIASVTMQNEPSNNPSWPMTTWTPEE
LVRWGVDYLRPALDRSFPEVEIFFGDDGLRFFSRPVSDYMTPAEAQSFAGTAMHTYSGLP
KWVVNATRQFPGWRSVMSERRCMLDEQVDEASHVMFGEIGIGLVRQGVGMIDLWNLALDE
RGLPSWARTMGRRGVITVDSQTGGVKRNLEYFMLRNFGQDVPVGARRVASTSHTGDGRTG
GLGSVAFIRDDGELSVILYNPTKEPIRAALTVNGWGASWRPVSVPAFGTVSCHISGSDRL
NCSTVPEDDQFVVHMTPHPADDHYEGEDDQA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagatttggaccgcaacggcaggggacctgtcccagcggcgagaacctatagcg
accccggagacgacaactgggcccggcgcggccgtccccatcgtcattgatccaaccaga
cgctatcagtactgggagggggccggcgctgctctgacggactccagtgcctacctgttc
atgacggccatggatgctgaccaacgtcatcggattctgactgagctcttcgatccggct
caggcgggcctatccaccttgaggatctccatcgggtcctgcgatttctccagccagcgt
tactactcctatgatgagctgcccgagggcgtgatgtcggattcggatatgacatacttc
tccattgggcaggggaagccgggctcgcccgaggccaccaaggacatgaagtacgtggtc
cccgtccttcaggagatcatggccatcaacccgggcgtacggattatggcttcgccctgg
agcgcgcctgcctggatgaaggacagcggtcagctggagggtgctgggcgtctacggttg
gggcaatactgtggcaacggctaccgcccgcgggatacggtagacgctgcctatgcccgc
tatttcatccggtttatccaggcttaccaggagcttggcattcccattgcgtccgtcacc
atgcagaacgagccctccaacaatccttcctggcctatgacgacctggacccccgaagag
ctggtgcgctggggggtggactacctgcgtccggcactcgatcgcagcttccctgaggtg
gagatcttcttcggcgatgacggcctgagattcttcagccgtccggtcagcgactatatg
acccctgccgaggcccagagcttcgccgggacggccatgcatacatattccggcctgccc
aaatgggtcgtgaacgccaccaggcagttccccggatggcgttcggtcatgagtgagcgg
cgctgcatgctggacgagcaggtggacgaggccagccatgtcatgttcggggagataggc
atcggacttgtccgtcagggcgtgggcatgatcgacctgtggaatctggccctggatgag
cggggtctgcccagctgggcgagaaccatgggccggcgcggggtcatcaccgtcgattcc
caaactggcggagtcaagcgaaacctggaatatttcatgctccgtaatttcggacaggat
gtgccggtcggcgctcgcagggtggcctccaccagccataccggtgacggtcggaccggt
ggtctgggatcggtcgccttcatccgcgacgacggcgagctcagcgttatcctctataat
ccgaccaaagaacccatccgtgcggccctgaccgtcaatggctggggcgcaagctggcga
ccggtaagcgtacctgctttcgggacggtctcctgccatatctcaggctccgatcgcctc
aactgcagcacggtgcccgaggatgaccaattcgtcgtccatatgactccgcacccagct
gacgaccattacgagggggaggacgaccaggcctga

DBGET integrated database retrieval system