KEGG   Bifidobacterium asteroides: BAST_1544Help
Entry
BAST_1544         CDS       T02271                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bast  Bifidobacterium asteroides
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bast03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1969721..1970323)
Genome map
AA seq 200 aa AA seqDB search
MAATYDGAIQELIDAFAQLPGIGPKGAQRIAFYILGADRRSAQDLADAIVAAKEKVRFCE
ICGNVCETSPCPICQDPRRDRSIICVVEEPKDVMSIERTGEYRGLYHVLGGAIDPMSNVG
PGDLRIPELLKRLGTDQVKEVMLALDPNIEGEATTTYLGRLLGPLDLRVTRLASGLPVGS
DLEYADEITLGRAISGRRDL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctgctacctatgatggggccattcaagagctgatcgatgcctttgcccagctgcct
ggcatcggtcccaagggtgcacagcgcatcgccttttacattctgggggccgatcggcgc
agcgctcaggatctggccgatgccattgtcgccgccaaggagaaggttcggttttgcgag
atctgtggcaatgtctgcgagaccagcccatgccccatctgtcaggatccgcgtcgtgac
cgcagcatcatctgcgtagtcgaggagcccaaggacgtgatgagcatcgaacgtaccgga
gaataccggggtctatatcatgtgctgggtggggccatcgaccccatgtccaacgtcggg
ccaggcgatctgcgcattcccgagctcttgaaacggttgggcacggatcaggtcaaggag
gtcatgctggcactggatcccaacatcgaaggcgaagccaccaccacctacctgggacgg
ttgctgggtcctctggatctgcgggtcaccaggctggccagcggcctgcccgtcggcagc
gatttggaatatgctgacgagatcacccttggccgtgcaatatccggtcgccgcgatctg
taa

DBGET integrated database retrieval system