KEGG   Bifidobacterium asteroides: BAST_1603Help
Entry
BAST_1603         CDS       T02271                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bast  Bifidobacterium asteroides
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAST_1603
Enzymes [BR:bast01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BAST_1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2039145..2041016
Genome map
AA seq 623 aa AA seqDB search
MNIKDIAQLAGVSTSTVSKIVNHKDASITAATRDRVLELVRKYHYTPYGSSKPNTTTWRI
GVLLSSSISMDSTLDGIIQQAQKSGYGTLVFNSYGNHDQEERNILAALEHRVDGMVWEPI
DRTSLALKGKIEAQGIPELTIGPLGDDRTALMPYEEAAYSLTEELIKRHHTSIACLLSPG
RRTQSFLHGYRRCLFDHNIQYHTDMVLETIGEDLTQVLENRQVTGIVASHYHHALEFLQF
AESMHYRLPQDLSLVSLMNDTNVHLRYPGSPEISSYVMRNADFGAYLCRRIIHAIEHESD
RSETFEHVFTLDGEKTVGPPPDQQCKKIVVVGSINVDTYLTAPSLPKAGMTTTTRNFAST
PGGKATNQAVGVARLEHQVSLIGNVGSDPAADYIYKTMRQAHVDATGVRRVTGADTGKAY
IFVDGKGESMISLVAGANESLTPDDITERDQIFRNTGYCLIQTEIPMDTVAEACRTAKRH
QAATIVKPSSCDHLPEDLLASIDILIPNLNELNTLIPGAGSVVDKAKRFIDGGVGRVIIT
QGERGCTLVTSSDHKDFPAHETRAIDDTGASDAFISALASYLCSGCTLDKAAHIANLAAG
FSIAHEGVIPSLINRRQLEGLID
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaaggacattgctcagcttgccggcgtatccacatcgacggtctccaagatt
gtgaatcacaaggacgcgagcatcacagccgccacgcgcgacagggtccttgaactggtc
aggaagtaccactacacgccctacggatcctccaagcccaacaccaccacctggagaatc
ggagtcctgctcagctcatccatctccatggactccaccttggatgggatcatccagcag
gcacaaaagtcggggtacggcactctggttttcaacagctacggcaatcacgaccaggag
gaacgcaacatcctggcagctctggaacatcgagtggatggtatggtctgggagccgatc
gaccgcacaagcctggccttgaaaggcaagatcgaagcacaagggattcccgaattgacc
attggacccctgggagacgaccggaccgcgctcatgccctatgaggaggctgcatacagt
cttactgaagagctgatcaagcgccaccacaccagcatcgcctgtctgctctcgccaggc
aggcggacccagagcttcctgcacggttatcgtcgctgcctgttcgaccacaacatccaa
taccacaccgacatggtcctggaaaccatcggcgaggacctgacccaggtgctggagaac
cggcaggtcaccggaatcgtggcatcccactatcaccatgccctggaattcctccagttc
gccgaatccatgcattaccgtctgccccaggacctctccctggtctccctgatgaacgac
accaacgtgcacctacgctaccctggcagcccggagatatcgtcctacgtcatgcgcaac
gccgacttcggcgcctacctgtgcagacgaatcatccacgccatcgagcatgagtctgat
cgaagcgagacctttgagcacgtcttcaccctggacggcgagaagaccgtcggcccgccc
ccggaccagcaatgcaagaagatcgtggtggtcggcagcatcaacgtggacacctatctg
accgcccccagcctgcccaaggcgggtatgaccaccacgaccaggaacttcgcctccaca
ccggggggcaaggccaccaaccaggcggtgggcgtggccaggctggagcatcaggtttcc
ctgatcggcaatgtcggcagcgatccggccgcagactacatctacaaaaccatgaggcag
gcccatgtggatgccaccggtgtgcgcagagtcaccggagcggacacgggcaaagcctac
atcttcgtcgacggcaagggtgagtcgatgatctccctggtggcgggcgccaacgaatcc
ctgaccccggacgacatcaccgagcgcgaccagatcttccggaacaccggctactgccta
atccagacagagatccccatggacactgtcgccgaggcctgcagaacagccaagcgccac
caggccgccaccatcgtcaaaccgtcatcctgcgaccacctgcctgaagacctgctggct
tcgatcgacatcctgatcccgaatctgaacgagttgaacaccctgatacccggagcagga
tccgtggtggacaaggcgaaacggttcatagacggcggggtgggcagggtcatcatcacc
cagggcgagcgcggctgcaccctggtcacttccagcgatcacaaggacttcccagcccac
gagacccgagcaatcgacgacaccggcgccagcgatgccttcatcagcgccctggcctcc
tatctgtgcagcggatgcaccctggacaaagccgctcacattgctaatctggccgccggc
ttcagcatcgcccacgaaggcgtcatcccctccctgatcaaccgccgccagctggagggc
ctgatcgactga

DBGET integrated database retrieval system