KEGG   Bifidobacterium asteroides: BAST_1631Help
Entry
BAST_1631         CDS       T02271                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bast  Bifidobacterium asteroides
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BAST_1631
Enzymes [BR:bast01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     BAST_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2073211..2074791)
Genome map
AA seq 526 aa AA seqDB search
MDNKVQLITYANRFGGDTLASLTRVLRTYFDGVYQGVHILPFFTPYDGADAGFDPIDHRQ
VDPRLGTWDDVAELSRSHKIMVDAIVNHMSSESEQFREVRVKGKASPYYSMFLTMSSVFP
DGADEEDLARIYRPRPGLPFTHYIWAGETRLVWTTFTPQQVDIDTDSSQGWAYLTSILDR
LAASNVSYIRLDAVGYGAKQAGTSCFMTPKTFDLITRIKQEAATRGLETLIEVHSNYRKQ
IDIASKVDRVYDFALPPLLLHTIFTGDIAALAHWIEVRPINAVTVLDTHDGIGVIDIGAD
QMNRSLKGLVDDAAVDQLVRTIHCNTHGQSEAATGAAASNLDLYQINTTYYSALACHDRA
YLAARAVQFFLPGVPQVYYVGALAGANDMDLLARTRNGRDINRHYYTEGEIERNLTRPVV
RSLNALCRLRNKLDAFNGKFSYRIDATRGALRLVWQGKTSKAELIFCPFAAIGTFPALSD
RTETIGENGGNASPQSSGKDPSLATLVWSDAQGSHLCRDLLTDLGE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaaggttcaactcattacatatgcaaacaggtttggaggcgataccctggcc
tccttgaccagagtgttgcgtacgtattttgatggcgtgtatcagggggtccacattctg
ccttttttcaccccctacgatggtgctgatgccggcttcgatcccattgaccatcgtcag
gtggatccaaggctgggcacttgggacgacgtcgcggagctgagtcgatcgcacaaaatc
atggttgacgctatcgtcaatcacatgtcctcggagtccgagcagttccgggaggtcagg
gtcaaggggaaggcgagcccgtactattcgatgttcttgaccatgtcttcggtctttcct
gatggggctgatgaagaagatctggcgcgcatatatcggccgcgcccgggcctgcctttc
acccactatatctgggcaggcgaaacccggctggtctggactacttttactccacagcaa
gttgacatcgacaccgattcgtcccagggatgggcgtatctgacgtctatacttgatcgt
ttggcggccagcaatgtcagctacatccgtttggatgccgtcgggtatggagccaagcag
gcaggcaccagttgttttatgacgcccaagactttcgacctcatcactcgtatcaaacag
gaagctgccactcggggtttggagactttgattgaggtccactccaattatcgcaagcag
attgatatagcctccaaagtcgacagggtttacgatttcgccctgccgcctctgctgctg
catacgatcttcactggagatatcgcggcactggcccattggatcgaggtcagaccgatc
aatgcggtcactgtcctggatacccatgatgggatcggagtgatagatatcggcgctgac
cagatgaaccgttcactgaaagggctcgtggatgatgcggccgtggaccaactggtccgg
acaattcactgcaacactcacggccaatcggaagctgccactggagctgctgccagcaat
ctggacctgtatcaaatcaatacgacctattactcggcattggcttgccatgacagggcc
tacctggctgcaagagccgttcagttcttccttccaggggtgcctcaggtctattatgtc
ggggcactggccggtgccaatgacatggatctgctggcgagaacccgcaatggtcgagat
atcaacaggcactactacaccgaaggggagattgagcggaatctgacaagaccggtcgtt
cgctccttgaacgctctgtgtcgattgcgcaataagctggatgccttcaatggcaaattc
tcttatcgaatcgatgcgacacgtggcgcgcttcgtcttgtctggcagggaaagactagt
aaggctgagctgatcttctgcccattcgccgctatcggcaccttcccggctctgagtgac
cgaacggagacaataggggaaaacggcggaaatgccagcccgcaatcgtcaggcaaagat
ccctctctcgccacgttggtctggtcggatgctcagggttcgcacctatgtcgtgatttg
ttgacagacctgggcgagtga

DBGET integrated database retrieval system