KEGG   Bifidobacterium asteroides: BAST_1677Help
Entry
BAST_1677         CDS       T02271                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bast  Bifidobacterium asteroides
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAST_1677
Enzymes [BR:bast01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BAST_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2132144..2133064
Genome map
AA seq 306 aa AA seqDB search
MSPAAGGDGIALYCPAKINLRLRVGPAQAELGGRHRLDTIYSAVGIWDRVELRRTEPGNG
FRLSLEGDHLGDLNRRDANPRANLAVKALLAMAQATGHQPDVAIHILKRIPVGAGLAGGS
ADAAGTMLGLNRLWNLGMAAAELDRIAARLGADLPFCLHGGLSRGTGFGQILEPLDPDGL
QAQRLSRAGLTGHLLIGAYEDQLSTAHVYKAFDLIGPGPNDPNDLQETACTLHPRSRQAL
DLARQAGIGPAFVSGSGPSVVVMAPHPEQAIALIRLWREQNAVDRIIEADSPVLPRMVPL
RVTHGQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccggcagccggaggggacggcattgccctctactgtcccgccaagatcaatctg
aggcttcgtgtcggtccggcccaagccgaacttggagggcgacaccgcctggacaccatt
tacagcgctgtgggaatctgggatcgggtggaactacgtcggacagaacccggcaacggc
ttccgcttgagcctggagggcgaccacttgggcgacctgaaccgccgggatgccaatcca
cgcgccaacctggccgtcaaggcccttctggccatggcacaggccaccgggcaccagcct
gatgtggctatccacatcctcaaacggataccggtgggcgctgggctggccggtggatcc
gcggatgctgccggaaccatgctggggttgaaccggctctggaatcttggaatggctgcc
gccgagctggaccgcatcgccgccaggctgggcgcggacctgcccttctgcctgcatgga
gggctcagcagaggtacaggtttcggccaaattcttgagcccctggatccggatggcctg
caggcccagcggctgtcccgtgctgggctgaccggacacctcctgatcggtgcctacgaa
gatcagctgagcacagcccatgtctacaaggccttcgatctgatcggacccggccccaac
gacccgaacgacctgcaggagaccgcctgcaccctgcacccgcgctcgcgccaggctctg
gaccttgcccggcaggcaggcatcggaccggccttcgtctctggatcgggcccctccgtg
gtggtcatggcccctcaccccgagcaggcaatcgcattgataaggctctggcgggagcaa
aatgccgtggacaggataatcgaggctgactcgccagtcctgcccaggatggtccccctg
agagtcacccatggacagtag

DBGET integrated database retrieval system