KEGG   Bacillus anthracis Sterne: BAS0017Help
Entry
BAS0017           CDS       T00184                                 

Definition
(RefSeq) deoxyadenosine/deoxycytidine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00230  Purine metabolism
bat00240  Pyrimidine metabolism
bat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BAS0017
   00240 Pyrimidine metabolism
    BAS0017
Enzymes [BR:bat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BAS0017
    2.7.1.76  2'-deoxyadenosine kinase
     BAS0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Cytidylate_kin2 AAA_33 TsaE Thymidylate_kin AAA_28 AAA_29 CbiA PRK RNA_helicase AAA_25 RsgA_GTPase ParA AAA_16 ABC_tran IstB_IS21 AAA MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 2851409
NCBI-ProteinID: YP_026305
Position
complement(22457..23125)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatataccaaatgacgcagtaatcactatcgctggaaca
gtaggtgtcggtaaatccactatgacaactgcattagctaacgctttaggatatcgcaca
tcatttgaaaaggtagattctaacccgtatttggacaagttctatgctgatttcacacgc
tggagctttcacttacaagtgtactttttagcagaacgatttaaagaacaaaaaaggatt
tttgaatacggtggtggttttgttcaagatcgctctatctatgaagacactggcattttt
gcaaaaatgcatcacgaaaagggtacaatgacggaaactgattatgaaacatataaaggt
ttatttgacgctatggtcatgactccttacttccctcatccagatttactaatctactta
gaaggttctttcgatgatatcgttgatcgtatccaagaacgtggacgtccgatggaacag
caaacgccaattgagtattggaaagagatgcatgggcgttatgaaaactggattaataac
tttaattcatgccctgtcttacgattaaatattaatgaatacgatattttaaaagatggc
gattccattgaaccaatcattaaaaagatcggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system