KEGG   Bacillus anthracis Sterne: BAS0023Help
Entry
BAS0023           CDS       T00184                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bat  Bacillus anthracis Sterne
Pathway
bat03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAS0023 (recR)
DNA repair and recombination proteins [BR:bat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BAS0023 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BAS0023 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 Toprim_2
Motif
Other DBs
NCBI-GeneID: 2852490
NCBI-ProteinID: YP_026311
UniProt: Q81W16
Position
27568..28164
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccaatatcaaaactaattgatagttttatgaaattgccaggaatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagatgatgtg
ttaggttttgcaaaagcacttgtaaatgcaaagcgagacttagcgtattgttccgtatgt
gggcatattactgaccgtgacccttgttatatttgtaacgattcacatcgagatcaatca
gtggtttgtgtcgtacaagaaccgaaagatgtaatcgcgatggaaaagatgaaagagtat
caaggtgtatatcatgtgttacgtggtgctatctctccaatggggggaattggaccagaa
gacattaatatcccgcagcttttaaagcgactgcacgatgaaacggtacaagaagtaata
ttagcaacaaatcctaatattgaaggggaagctacagcgatgtatatatcccgcctctta
aagccgacaggtattaaagtaactcgtattgcacatggtctgccggttggtggagattta
gaatatgcagatgaagtgacactgtcgaaagcgttagaaggtcgtagagaagtataa

DBGET integrated database retrieval system