KEGG   Bacillus anthracis Sterne: BAS0071Help
Entry
BAS0071           CDS       T00184                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bat  Bacillus anthracis Sterne
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bat00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77498..78340
Genome map
AA seq 280 aa AA seqDB search
MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGA
HIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAH
IINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVR
DENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEG
TGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKGVK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagtttgaagtgggattatgatttgcgctgcggcgaatatacattgaacttaaat
gaaaaaacattaattatggggattttaaatgtaacaccagattcgttttctgatggtggg
agttataatgaggtagatgctgcagtgcgccatgcgaaagaaatgcgagatgaaggtgct
catattattgatattggtggcgaatctactcgtccgggttttgctaaagtatcggtggaa
gaagaaataaaacgagttgttccgatgattcaggctgtttcaaaagaggtaaaattgcct
atttctatcgacacgtataaagctgaagttgcaaaacaagcaattgaagctggtgctcat
attattaatgatatttggggagcgaaggcagaaccaaaaatcgctgaagttgcagctcat
tacgatgtacctattatcttaatgcacaatcgcgataacatgaattatcgcaatttaatg
gctgatatgattgctgacttatatgacagtattaaaattgctaaagatgctggtgtgcga
gatgagaatatcattttagacccgggtatcggttttgctaaaacacctgaacaaaattta
gaagcgatgcgtaatttagaacagttaaacgtactaggttatccagttctcttaggtact
tcaagaaagtcctttattgggcatgtgctagatttaccggtagaagaacgtcttgaggga
acgggagctaccgtttgtcttggtattgaaaagggttgtgagtttgttcgcgttcatgat
gtgaaggaaatgtcgcgtatggctaagatgatggatgcgatgattggtaagggggtaaag
taa

DBGET integrated database retrieval system