KEGG   Bacillus anthracis Sterne: BAS0333Help
Entry
BAS0333           CDS       T00184                                 

Definition
(RefSeq) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00051  Fructose and mannose metabolism
bat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BAS0333
Enzymes [BR:bat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BAS0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 2850599
NCBI-ProteinID: YP_026613
Position
359404..360045
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANHIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagagagagaagagattgtagcgtacggaaagaaaatgatttctagc
ggtttaacaaaggggacaggcggtaatattagtattttcaatcgcgagcaaggtcttgtt
gccattagcccaagtggtttagattattatgaaacaaagcctgaagatgtagttatatta
aacttagatggtgaagtagtagagggagagagaaaaccatcaagtgaactcgatatgcac
cttatttattatagaaatcgtgaagatataaatgcgcttgtgcatacacattctccttat
gcgaagacgattgcatcattaggatgggaactgcccgcagtatcatatttaattgctttc
gcaggcccgaatgttcgctgtgcaccgtatgaaacatttggtacgaagcaattagcagag
gctgctttcgaaggaatgatcgatcgtcgtgctgttttacttgcgaaccacggtttaatt
gcgggtgcaaatcatatcaaaatggcatttaccgttgcagaagaaattgagttttgtgcg
caaatttattatcaaacgaaaagcattggggaaccgaagctattgccagaagacgagatg
gagaatttggcgaagaagtttgaagggtatgggcagcagtag

DBGET integrated database retrieval system