KEGG   Bacillus anthracis Sterne: BAS0586Help
Entry
BAS0586           CDS       T00184                                 

Definition
2-amino-3-ketobutyrate CoA ligase (EC:2.3.1.29)
Orthology
K00639  
glycine C-acetyltransferase [EC:2.3.1.29]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycine, serine and threonine metabolism
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bat00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634182..635372
Genome map
AA seq 396 aa AA seqDB search
MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYINLSSNNYLGLATDSR
LQEAAIGAIHKYGVGAGAVRTINGTLDLHIKLEETIAKFKHTEAAIAYQSGFNCNMAAIS
AVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQKAIAAKESGLYNKLMVI
TDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSGVLGKGAGTVKHFGLSDKVDFQIG
TLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTAVTPADAAACMRSIEILMESTELHDR
LWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEFSKRLNEEGVYAKSIVFPTVA
KGTGRVRNMPTAAHTKEMLDEAIRKYEKVGKEMGII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaaaacacttgcgaaatttttagaagaaaatttagaggatttaaaatcaaag
gggctttataacgtaattgatccgcttgaaagttcaaatggaccgatcattacaattggc
ggaaaagaatatattaacttatcttcaaacaactatcttggattagcaacagatagccgt
ttgcaagaagcagcaattggtgcaattcataagtacggcgttggagcaggagcggttcgt
acaattaacggtactttagatttgcatattaaattagaagaaacaattgcaaagtttaaa
catacagaagcagcgattgcttatcaatcaggatttaattgtaatatggcagcgatttca
gccgttatggataaaaatgatgcgattctttcagacgagttaaaccatgcttctattatt
gatggtagtcgtctatcaaaagcaaaaattattgtttataaacattctgatatggaagat
ttacgccaaaaagcaatcgcggcgaaagaatcaggtctttacaataaattaatggtaatt
acagacggtgtcttttcaatggatggagatgttgcaaaactaccagaaattgttgagatt
gcggaagaattagatttaatgacatacgtagacgatgcacacggttcaggtgtacttgga
aaaggtgcaggaacggtaaagcacttcggtctgtctgataaagttgatttccaaattggt
acattatcaaaagcaattggggtaattggtggatatgtagcagggaaacaaaacttaatt
gactggttaaaagttcgttcacgtccattcttattctctacagcagtaacgccagctgat
gcagcggcttgcatgagatcaattgaaatcttaatggaaagcacagagttgcacgatcgt
ttatgggaaaatggtcgctatttaaaacaagggttaaaagaacttggctttaacatcgga
gaaagtgaaacgccaattacaccttgtattattggtgacgaagtattaacacaagaattt
agtaaacgtctaaatgaagaaggcgtatatgcaaaatctatcgtgttcccaactgtagct
aaaggaaccggacgcgttcgtaatatgccaacagcagctcatacgaaagaaatgttagat
gaagcaattcgtaagtatgaaaaagtagggaaagaaatgggcatcatttaa

DBGET integrated database retrieval system