KEGG   Bacillus anthracis Sterne: BAS0586Help
Entry
BAS0586           CDS       T00184                                 

Definition
2-amino-3-ketobutyrate CoA ligase (EC:2.3.1.29)
Orthology
K00639  
glycine C-acetyltransferase [EC:2.3.1.29]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAS0586
Enzymes [BR:bat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.29  glycine C-acetyltransferase
     BAS0586
Amino acid related enzymes [BR:bat01007]
 Aminotransferase (transaminase)
  Class II
   BAS0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634182..635372
Genome map
AA seq 396 aa AA seqDB search
MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYINLSSNNYLGLATDSR
LQEAAIGAIHKYGVGAGAVRTINGTLDLHIKLEETIAKFKHTEAAIAYQSGFNCNMAAIS
AVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQKAIAAKESGLYNKLMVI
TDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSGVLGKGAGTVKHFGLSDKVDFQIG
TLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTAVTPADAAACMRSIEILMESTELHDR
LWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEFSKRLNEEGVYAKSIVFPTVA
KGTGRVRNMPTAAHTKEMLDEAIRKYEKVGKEMGII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaaaacacttgcgaaatttttagaagaaaatttagaggatttaaaatcaaag
gggctttataacgtaattgatccgcttgaaagttcaaatggaccgatcattacaattggc
ggaaaagaatatattaacttatcttcaaacaactatcttggattagcaacagatagccgt
ttgcaagaagcagcaattggtgcaattcataagtacggcgttggagcaggagcggttcgt
acaattaacggtactttagatttgcatattaaattagaagaaacaattgcaaagtttaaa
catacagaagcagcgattgcttatcaatcaggatttaattgtaatatggcagcgatttca
gccgttatggataaaaatgatgcgattctttcagacgagttaaaccatgcttctattatt
gatggtagtcgtctatcaaaagcaaaaattattgtttataaacattctgatatggaagat
ttacgccaaaaagcaatcgcggcgaaagaatcaggtctttacaataaattaatggtaatt
acagacggtgtcttttcaatggatggagatgttgcaaaactaccagaaattgttgagatt
gcggaagaattagatttaatgacatacgtagacgatgcacacggttcaggtgtacttgga
aaaggtgcaggaacggtaaagcacttcggtctgtctgataaagttgatttccaaattggt
acattatcaaaagcaattggggtaattggtggatatgtagcagggaaacaaaacttaatt
gactggttaaaagttcgttcacgtccattcttattctctacagcagtaacgccagctgat
gcagcggcttgcatgagatcaattgaaatcttaatggaaagcacagagttgcacgatcgt
ttatgggaaaatggtcgctatttaaaacaagggttaaaagaacttggctttaacatcgga
gaaagtgaaacgccaattacaccttgtattattggtgacgaagtattaacacaagaattt
agtaaacgtctaaatgaagaaggcgtatatgcaaaatctatcgtgttcccaactgtagct
aaaggaaccggacgcgttcgtaatatgccaacagcagctcatacgaaagaaatgttagat
gaagcaattcgtaagtatgaaaaagtagggaaagaaatgggcatcatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system