KEGG   Bacillus anthracis Sterne: BAS1051Help
Entry
BAS1051           CDS       T00184                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bat  Bacillus anthracis Sterne
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAS1051
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAS1051
   00630 Glyoxylate and dicarboxylate metabolism
    BAS1051
Enzymes [BR:bat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BAS1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1104569..1106158
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEALSFLKELHENFNERRIELLQKRMKKQQKIDAGEF
PKFLEETKRIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKAFRNHNEFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgtgggagaaatgttaccagcgtacaacgaa
atattgacacctgaggcgcttagttttttaaaggaactacatgaaaattttaatgagcgc
cgcatagaacttttacaaaagcgtatgaaaaaacaacagaaaattgatgcaggagagttt
ccgaagtttttagaagaaacaaagcgtatacgtgaagcggattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggtccagtagatagaaagatggtt
attaacgctttaaattcgggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcaattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcgtttaaatagtaaaacagctgtatta
attgtgcgtccaaggggatggcatttagaagaaaaacatatgcaagttgacggaaaaaat
atgtctggtagcttagtagatttcggactttattttttccataatgcgaaagctctttta
gaaaaaggaagcggtccatacttttacttaccgaaaatggaaagctatttagaagcaaga
ttatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaatggaacgatc
aaagcaacggtgttactggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ctaaaagctttccgtaatcataatgaatttttacttcctgatagagcgcaagtcacgatg
acggcgccgtttatgcgcgcgtattctttgaaagtcattcaaacttgtcaccgccgtaat
gcaccagctattggagggatggcagcacaaattccgattaaaaacaatcctgaagcgaat
gaagctgcttttgaaaaagtgcgtgctgataaggagcgagaagctttagacggtcatgac
gggacttgggttgcccacccgggacttgtgccagtcgcgatggaagtatttaatcacatt
atgaaaacaccgaatcaaatttttagaaaacgagaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtatgaatattagcgta
ggcattcaatatatcgcatcttggttaagcggacggggagcagcaccaatttataactta
atggaagatgcggcaacagctgaaatctcaagagcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagttaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaagaaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcggaatgatgaattcgtaccattt
ttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system