KEGG   Bacillus anthracis Sterne: BAS1074Help
Entry
BAS1074           CDS       T00184                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bat  Bacillus anthracis Sterne
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAS1074
Enzymes [BR:bat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BAS1074
Peptidases [BR:bat01002]
 Cysteine Peptidases
  Family C44
   BAS1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1125996..1127843
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDYKRSLEGERDVVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGK
QPMTCLKDEANYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEECVDH
LNGIYAFAVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEVTLE
GLSEIFGLGPSRTPGHGIYTGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEETVE
KTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYEKSGKGQLHTYSVDYEDND
KYFKANAFQPNSDAPFIHLMTETFQTIHHRCVISNEQLAQYLTEAVLVRDLPGMADIDSS
LLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKKEWR
NKLNLQQYVQQRYEESIQEVPILDGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGLLPNDILYRKKSPYPKTHNP
HYTKAVTVWIQDLLTDKGSILHELFDKEQLSGLIESGGSAFQTPWYGQLMTGPQLLAHLA
QIHVWFKEYGVNIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattacaggatgggtggattataaacgctcattagaaggagaacgggacgtc
gttacgaagatggctgagacgttagcgaagcgtggtccagatgataataaagtttggatt
aaaggcaatgtcgcatttgggcataaacggttaatcgttgttgatcctgaaggtggtaaa
cagccgatgacttgtttaaaggatgaagcaaattatgcaatttgctataacggcgaactg
tataacacggaagacattcgaaaggaactattaagaagaggatatacgttcaaaggtcac
tctgatacggaagtattgttagcttcttatatcgaatggaaagaagaatgtgtcgatcat
ttaaacggtatatatgcgtttgctgtatgggatgaacagaaagaacaagtgtttattgcg
cgcgatcgattaggggtaaaaccactattttataaatatgacagtgggcgattactattt
ggctcagagttaaaagcgatattggcgcatccagatgtgaaggcggaagtgacgttagaa
ggattatctgaaatatttggccttggaccatctagaacgcctggtcacggtatttatact
ggcataaaagaattacgtccaggtcatgcgatgacattttcgaagaacggtttatgtata
tggagatattggaatgtagaaagtaaaaagcatgaagattcttttgaagaaacagtagaa
aaaacacgctttttattacaagatgcgattacaaggcagctcgtttctgatgtaccatta
tgcacttttttatcaggcggtgtagattcaagcgctataacagcaattgctgcgaaagaa
tacgaaaaatcgggaaaaggtcaattacacacgtattcggttgattacgaagataatgac
aaatactttaaagcaaatgcgtttcagccaaattcagatgcaccatttattcatttgatg
actgagacgtttcaaacgatccatcatcgttgcgtcatttcaaatgaacaattagcgcag
tatttaacagaagcagtactcgttcgtgatttgcctggtatggcagatattgattcgtca
ttattatggttttgtcgtgaaattaaacaagattttgtcgttggtttatctggggaatgt
gcagatgaaatatttggtggttatccatggttttatagagaagatgatttacaatcgagt
gcatttccgtggatgcgttctacagaagcgcgtgaacaattgctaaagaaagaatggaga
aataaattaaatttacaacaatatgtacagcagcgctatgaagaatccattcaagaagtt
cctattttagatggggaaagtccgctagaagcaaaaagacgccaattattttatttaaat
atggtatggtttatgacaacattattagacagaaaagaccgcatgagtatgggggcaagc
ttagaagtgcgcgttccatttgcagatcaccgacttgtcgaatatgcgtggaatattcct
tgggaaatgaaaatgtataaaaaccgcgaaaaaggtctattgcgtaaagcgttagaaggg
ttacttccaaatgacatcttatatagaaagaagagcccgtatccaaaaacacataatccg
cactatacgaaagcagtaacagtatggatacaagatttattaacggataaaggctcaatt
ttacacgagctatttgataaagaacagctgagtggattaattgagtcaggcggcagtgca
ttccaaacgccatggtatggtcaattaatgactgggccacagcttttagctcatttagca
caaattcatgtttggtttaaagaatatggagtaaatattaaagaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system