KEGG   Bacillus anthracis Sterne: BAS1162Help
Entry
BAS1162           CDS       T00184                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAS1162 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAS1162 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAS1162 (trpA)
Enzymes [BR:bat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAS1162 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1208712..1209488
Genome map
AA seq 258 aa AA seqDB search
MGVERIKAAFENGKKAFIPYVMGGDGGLEILKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQIPFVLMTYLNPVLAFGKERFIENCMEAGV
DGIIVPDLPYEEQDIIAPLLREANIALIPLVTVTSPIERIKKITSESEGFVYAVTVAGVT
GVRQNFKDEIHSYLEKVKSHTHLPVVAGFGISTKEHVEEMVTICDGVVVGSKVIELLENE
KREEICEFIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaagaattaaagcagcatttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaatattaaaagaaagaattcgttttctagacgaa
gcgggagcaagcatcgttgaaattggtatcccgttttcagacccagtcgcagatggccca
acgattcaaagagcagggaaacgagcgctagatagcggtgtaacagtaaaaggcattttt
caagcattaatagaggtaaggaaagaagtgcaaattccgtttgtactcatgacatattta
aatccagtacttgcattcgggaaagaacgatttatcgagaactgtatggaagcaggtgta
gacggcatcatcgttccagacttaccgtatgaagaacaagacattattgctccgttactt
cgagaggcaaacattgcgctcattccacttgttactgttacgagcccaattgagcgaatc
aaaaaaattacgagtgaatcagaaggatttgtctacgccgttacagtagcgggcgtaaca
ggagtacgtcaaaattttaaagatgagattcatagttacttagaaaaagtgaaatcgcat
acacatttaccggtagtggcagggttcggtatttcaacaaaggaacatgtggaagaaatg
gttacaatatgtgatggtgttgtcgttggaagtaaagtgattgagctattagaaaatgaa
aaacgagaagaaatatgtgaattcatacaggcaacaaaacaaaaagaagaggcgtaa

DBGET integrated database retrieval system