KEGG   Bacillus anthracis Sterne: BAS1929Help
Entry
BAS1929           CDS       T00184                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00010  Glycolysis / Gluconeogenesis
bat00260  Glycine, serine and threonine metabolism
bat00680  Methane metabolism
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01200  Carbon metabolism
bat01230  Biosynthesis of amino acids
Module
bat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bat_M00002  Glycolysis, core module involving three-carbon compounds
bat_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS1929
  Energy metabolism
   00680 Methane metabolism
    BAS1929
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAS1929
Enzymes [BR:bat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAS1929
Membrane trafficking [BR:bat04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BAS1929
Exosome [BR:bat04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAS1929
  Exosomal proteins of melanoma cells
   BAS1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 2849218
NCBI-ProteinID: YP_028192
Position
1944822..1945412
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIDGE
QKTVHFINDTNHLHGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttaaacgtacatgaa
ggacgagctgactttgaattaacagaaaagggaagacagcaagtgcaaagacttgtacag
aaagtgaaagcagattttccaccagatttcatttgggcaagtacattaaaacgcgctcga
gaaactggtgaaacgttagcagaaggaattgggtgcccaattcaattagaagaggaatta
atggagtttaataatggagtgcaagcaggtctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggcatcttttctaaaatcgtgacggagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtctattacgtgcgtttttcaaaatgccaatttca
atggactattattttaaaatgggagatacgggaataagcttaattgaaattgacggtgaa
caaaaaacggtacatttcattaatgatacgaatcatttgcacgggatgtag

DBGET integrated database retrieval system