KEGG   Bacillus anthracis Sterne: BAS1929Help
Entry
BAS1929           CDS       T00184                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAS1929
   01230 Biosynthesis of amino acids
    BAS1929
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS1929
  Energy metabolism
   00680 Methane metabolism
    BAS1929
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAS1929
Enzymes [BR:bat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAS1929
Exosome [BR:bat04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAS1929
  Exosomal proteins of melanoma cells
   BAS1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1944822..1945412
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIDGE
QKTVHFINDTNHLHGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttaaacgtacatgaa
ggacgagctgactttgaattaacagaaaagggaagacagcaagtgcaaagacttgtacag
aaagtgaaagcagattttccaccagatttcatttgggcaagtacattaaaacgcgctcga
gaaactggtgaaacgttagcagaaggaattgggtgcccaattcaattagaagaggaatta
atggagtttaataatggagtgcaagcaggtctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggcatcttttctaaaatcgtgacggagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtctattacgtgcgtttttcaaaatgccaatttca
atggactattattttaaaatgggagatacgggaataagcttaattgaaattgacggtgaa
caaaaaacggtacatttcattaatgatacgaatcatttgcacgggatgtag

DBGET integrated database retrieval system