KEGG   Bacillus anthracis Sterne: BAS2095Help
Entry
BAS2095           CDS       T00184                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bat  Bacillus anthracis Sterne
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bat00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2099505..2101406
Genome map
AA seq 633 aa AA seqDB search
MCGFVGCLCENPREFSETEKHQFENMNTMIFHRGPDDEGYFRDEHVQFGFRRLSIIDLEA
GHQPLTYENDRYVIIFNGEIYNYVELREMLLEKGATFATQSDTEVIIALYAHMKEKCVDY
LRGMFAFMIWDREEKKLFGARDHFGIKPLYIAQQGDTTFFASEKKSIMHVMEDKGVNPTS
LQHYFTYQYGPEPETLTIDVNKIEPGHYFVKEIGKEMEIHRYWKPYFNASSATKEEHIQA
IRDVLYDSVKVHMRSDVPVGSFLSGGIDSSIIASIAREMNPNLLTFSVGFEQRGFSEVDV
AKETAEKLGVKNHNVFISAKEFMDEFPKIIWHMDDPLADPAAVPLYFVAKEARKHVTVVL
SGEGADELFGGYNIYREPNSLKMFSYIPSPGKSVLKALSGALKEGFKGKSFLERGCTPIE
ERYYGNAKIFREEEKAELMKYYNESVNYMDITKPLYNEIKDYDDVSKMQYIDMFTWLRGD
ILLKADKMTMANSLELRVPFLDKEVFDVASKIPTEFKIANGTTKAILREAARGIVPDHVL
DRKKLGFPVPIRHWLKDEMHDWAINIINESKTEHLIDKQYVLNLLEAHCADKGDYSRKIW
TVLAFMVWHQIYVEHKYDTNKFHEETKRAYSLV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttgtaggatgtttatgtgaaaaccctagagagttttcagaaacagaaaaa
catcaatttgaaaatatgaacacgatgattttccaccgtggtccagatgacgaaggatat
tttcgtgatgaacatgtacaatttggcttccgccgtttaagtatcattgacttagaggca
ggacatcagccgctaacttatgaaaatgatcgatatgtaattatttttaatggtgaaatt
tacaactatgtagaattacgtgaaatgttacttgaaaaaggtgcaacgtttgcaacgcaa
tctgatacagaagttatcattgcattgtatgcacatatgaaagaaaaatgtgtagactac
cttcgtggtatgtttgcatttatgatttgggatcgtgaagagaagaaacttttcggagca
cgtgatcacttcggtattaaacctttatacatcgcacaacaaggtgatactacattcttc
gcatctgagaagaaaagtattatgcatgtgatggaagataaaggcgttaatccaacgtca
ctacaacattactttacgtatcaatatggtccagagccagaaacattaacaattgatgtt
aataaaatcgagcctggtcattatttcgtaaaagaaatcggtaaagagatggaaatccat
cgctactggaaaccttatttcaatgcttcaagtgcaacgaaagaggaacatatccaagcg
attcgtgatgtgttatatgattcagtaaaagtgcatatgcgcagtgatgtaccagtaggt
tcattcttatctggtggtatcgattcatctattatcgcttctattgcaagagaaatgaat
ccaaatcttttaacattctctgttggttttgagcaacgtggttttagtgaagttgatgtt
gcgaaagaaactgctgagaaattaggcgttaaaaaccataacgtattcatttcagcgaaa
gagtttatggatgagttcccaaaaatcatttggcatatggatgatcctttagcagatccg
gcagctgtaccattgtacttcgttgcaaaagaagcacgtaaacatgtaacagttgttctt
tcaggtgaaggtgcagacgagctatttggtggttataacatttaccgtgagccaaactca
ctgaaaatgttctcttacattcctagcccaggtaagagcgttctaaaagcattaagtggt
gctcttaaagaaggctttaaaggaaagagcttcctagagcgtggatgtacgccaattgaa
gagcgttactatggaaacgcgaaaatcttccgtgaagaagagaaagctgaattaatgaag
tattacaatgaaagtgttaactatatggatatcacgaaaccattgtataacgaaattaaa
gattatgatgatgtaagtaaaatgcagtacattgacatgttcacatggttacgcggtgac
attttattaaaagctgataaaatgacaatggcgaattcattagaacttcgtgtaccgttc
ttagataaagaagtattcgatgttgcatctaaaattccaactgaatttaagattgctaac
ggaactacgaaagctattttacgtgaagcagcacgcggaatcgttccagatcacgtatta
gatcgtaaaaaacttggattcccagtaccaattcgtcactggctaaaagacgaaatgcat
gattgggctattaatattataaacgaaagtaagacagagcatttaatcgacaaacagtat
gtattaaacttactggaagcacattgtgcagataaaggcgattatagccgtaaaatttgg
actgtacttgcatttatggtatggcatcaaatttatgttgagcataaatacgatacgaat
aagttccacgaagaaacgaaacgtgcgtatagcttagtttaa

DBGET integrated database retrieval system