KEGG   Bacillus anthracis Sterne: BAS2412Help
Entry
BAS2412           CDS       T00184                                 

Definition
(RefSeq) hypothetical protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00010  Glycolysis / Gluconeogenesis
bat00071  Fatty acid degradation
bat00350  Tyrosine metabolism
bat00625  Chloroalkane and chloroalkene degradation
bat00626  Naphthalene degradation
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS2412
  Lipid metabolism
   00071 Fatty acid degradation
    BAS2412
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAS2412
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAS2412
   00626 Naphthalene degradation
    BAS2412
Enzymes [BR:bat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAS2412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C Flag1_repress
Motif
Other DBs
NCBI-GeneID: 2850788
NCBI-ProteinID: YP_028672
Position
2411001..2411927
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKCLKWKTCKIKSIQDDEIIVKTIAGAISIGAELPQFKGSDVTDMNPIYP
RKTGYESYGEVIQVGNKVTNLKVGDRVVSFYGHDTIGIVKGDKVIRVPSYIEPKDALLSI
LSCDAAKGILKLNPRQNEKILITGMGVIGLLACYFLKYYVGVKHVDVVEPNKNRRDFAKK
FCAKNIYESEEQIKEAFHYGFECSATNSGFHTLQKALKTNGQICILSDGNIEELTLTADF
YQKELQIIGSSDGYDYQKHADWFFSQIEQTPWIEEIFQHEIQYTELIQCFEELNQGIITP
LKVFVSYK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaatgccttaagtggaaaacgtgtaaa
ataaagtctatacaggatgatgaaattatcgttaaaacaattgcaggggcaataagtatt
ggagcagagttaccgcagtttaaaggatccgatgttacagatatgaatcctatttatcca
agaaaaactggatatgaaagttatggtgaggttattcaagttgggaataaagtaacaaat
ttaaaagtaggtgatagggtagtttctttttatggacatgatacgataggaatagttaaa
ggggataaagtaattcgagtgcctagttatatagaacctaaagatgccttattatctatt
ctttcgtgtgatgctgctaaaggcatattgaaactaaacccacgacagaatgaaaagata
cttataactggaatgggagttataggtttacttgcttgttatttcttaaaatactatgta
ggtgttaagcatgtagatgttgtcgaacctaataaaaatagaagagattttgcaaagaag
ttttgtgcaaaaaacatatatgaatcagaagaacaaataaaagaagcatttcattacggt
ttcgaatgttctgctacaaatagcggatttcatacattacaaaaagcacttaaaactaat
ggacaaatatgtatactttctgatggtaatattgaagaattaacattaaccgccgatttt
tatcagaaagaattgcaaatcattggttcaagtgatgggtatgattatcaaaaacatgca
gattggttttttagtcaaatagaacaaacaccatggatagaagagatttttcaacatgaa
atacaatatacagaactcattcaatgttttgaggaattaaatcaaggaataattacccct
ttaaaagtatttgtctcatataaataa

DBGET integrated database retrieval system