KEGG   Bacillus anthracis Sterne: BAS2414Help
Entry
BAS2414           CDS       T00184                                 

Definition
Mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bat  Bacillus anthracis Sterne
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAS2414
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAS2414
Enzymes [BR:bat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BAS2414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2413592..2414797
Genome map
AA seq 401 aa AA seqDB search
MKLKELANLLLVKETIGDMNVKITGLEMDSRKITNGNLFICVSGIDGFLEDRHQFVEDAV
KNGAVALIVERDVNIEIPKIIVKDARYAMAVIASHFYGYPSNKMKLIGITGTNGKTTTSY
LLEKILSDYGYHTGLMGNNGVKVGSKWYPTDINTQEPPTLQRNLQMMKNQNADYCVMEVT
SQGLHMERVKGCNFKIAVFTNLTQDHLDYHGTFDEYKHVKSLLFARLGNNLSTIDKKIAV
LNADDPSVEYFKKITSAEVITYGIHNGADVQAKNITLSPKGIRFLVSSFNGEIEVSLNLV
GRFNVYNALAAITVALVEGIPLTNISDSLSNLKSIEGRMEIIDENQDFLVIVDYAHTPDA
LENVLSTIREFAKGKIITVFGCGGDRDAKKTIYNGWNCWKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactaaaagagctggcgaatttgttattggttaaagaaactattggcgatatgaat
gtaaaaattacgggattagaaatggattctagaaagataactaatggtaacctatttata
tgtgtatcaggtatcgatggttttcttgaagatcgacatcaatttgttgaagatgcagtg
aaaaatggtgctgtagcgctaattgtagaaagagatgtaaatattgagatacctaaaata
attgttaaagatgctaggtatgctatggcagttattgcgtcacatttctatggttatcca
tctaataaaatgaagttaattggaattacagggacaaatgggaaaacaactacttcctat
ttacttgaaaaaattttaagtgattatggatatcacacggggctcatggggaataacgga
gtgaaagtgggttcaaaatggtatcctactgatattaatacgcaagaacctccaacactt
caacggaatttgcaaatgatgaaaaatcaaaatgcagattattgtgttatggaagttacg
tcacaagggttacatatggaaagagttaaagggtgtaactttaaaatagctgttttcaca
aatttaacacaagatcatttagattatcatggaacatttgatgaatataagcatgtaaaa
agtcttctttttgcgagattaggaaataatttatctactatagataaaaaaatagctgtt
ttgaatgcagacgatccatcggtagaatactttaaaaaaattacttcagctgaggttatc
acatatggaatacataatggagcagatgttcaagcgaagaacataactttaagtccaaaa
ggaattcgttttttagtttcgtcctttaatggcgaaatagaggttagccttaatcttgta
ggtcgttttaatgtttataatgcattagcagcaataacagttgcattggttgaaggtatt
ccgcttacaaacattagtgatagcttatctaacttaaagagtattgaaggtagaatggaa
atcatagatgaaaatcaagatttccttgtaatagtggactatgctcatacaccggatgcg
ttagaaaatgttctctctacaattagagagtttgcaaaaggtaaaattattactgttttc
ggttgtggtggagatagagacgcaaaaaaaacgatctataatgggtggaattgctggaag
ttatag

DBGET integrated database retrieval system