KEGG   Bacillus anthracis Sterne: BAS2586Help
Entry
BAS2586           CDS       T00184                                 

Definition
branched-chain alpha-keto acid dehydrogenase E2 subunit
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAS2586
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS2586
   00020 Citrate cycle (TCA cycle)
    BAS2586
   00620 Pyruvate metabolism
    BAS2586
Enzymes [BR:bat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAS2586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2580800..2581996)
Genome map
AA seq 398 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTILDIA
VSEDEGVPPGTVICYIGKPNEKVEVHESTKVEEELTASEVPQNVQHPEPLGKEVTNKQRI
KISPVAKKIAKTENLDIRALLGTGPGGRITKVDVLKALEERVAIPEVLEESKVLPVTGMR
KAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVVLA
LGEHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKEIKNAAQK
ARAGNLNSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGKKLKKG
SMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttagggatggcgatgaaagagggtattattacg
agctggaatattaaagcgggtgataatgtggcaaaaggagaattaattgccagtattaac
tcggaaaaaattgaaacggaaatagaagcaccagctgatggaactattcttgatatagct
gtaagtgaagatgagggggttccacctggcactgtaatttgctacattggtaaaccgaat
gaaaaagtagaggtacatgaaagcacaaaggttgaggaagaactgacagcgagtgaagta
ccacaaaatgtacaacatccagaaccgttagggaaagaagttacgaataaacaaagaatc
aaaatatctcctgtagcgaagaagattgcgaaaactgaaaatcttgatattagagcatta
cttggtacaggtccaggtggaagaattacaaaggtagatgtattaaaggcacttgaagaa
agagtagcaattccagaagtacttgaagaaagtaaagtacttcctgttactggtatgcgg
aaagcaatcgcaaatcgtatgcatgcaagcttacaaaatagtgcgcaattaacattaacg
atgaaagtagatgtgacagatttagttgctttacataaagaaatagcggaagttgtacaa
aaacgatacgataacaaattaaccattacggatttcgtttctcgagctgttgtattagcg
cttggggagcataaagaaatgaacagcgcttatatagatgatgcaattcatcaatttgaa
catgttcatttaggtatggcagtcgcattagaaaaaggattagtcgttccagctattcgc
ttcgcaaataatctctcattagtagagttatctaaagagattaagaatgcggcacaaaag
gcacgagcaggcaatttaaatagtgatgatatgcaaggaacaacatttacaattagtaat
ttaggaagcttcggtattgaatattttacacccgtattaaacacaccagaaactggtatt
ttaggtgtaggtgcaattgaacatgttcctgtatataaagggaaaaaattaaaaaaagga
agtatgttacctttaagtttaacattcgatcatcgtgtactagacggtgcaccagcagct
gcatttttacgcacaattaaacgctatttagaagaacctgtaacaattcttttataa

DBGET integrated database retrieval system