KEGG   Bacillus anthracis Sterne: BAS2586Help
Entry
BAS2586           CDS       T00184                                 

Definition
(RefSeq) acetoin cleaving system dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00010  Glycolysis / Gluconeogenesis
bat00020  Citrate cycle (TCA cycle)
bat00620  Pyruvate metabolism
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01200  Carbon metabolism
Module
bat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS2586
   00020 Citrate cycle (TCA cycle)
    BAS2586
   00620 Pyruvate metabolism
    BAS2586
Enzymes [BR:bat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAS2586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-GeneID: 2850490
NCBI-ProteinID: YP_028845
Position
complement(2580800..2581996)
Genome map
AA seq 398 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTILDIA
VSEDEGVPPGTVICYIGKPNEKVEVHESTKVEEELTASEVPQNVQHPEPLGKEVTNKQRI
KISPVAKKIAKTENLDIRALLGTGPGGRITKVDVLKALEERVAIPEVLEESKVLPVTGMR
KAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVVLA
LGEHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKEIKNAAQK
ARAGNLNSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGKKLKKG
SMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttagggatggcgatgaaagagggtattattacg
agctggaatattaaagcgggtgataatgtggcaaaaggagaattaattgccagtattaac
tcggaaaaaattgaaacggaaatagaagcaccagctgatggaactattcttgatatagct
gtaagtgaagatgagggggttccacctggcactgtaatttgctacattggtaaaccgaat
gaaaaagtagaggtacatgaaagcacaaaggttgaggaagaactgacagcgagtgaagta
ccacaaaatgtacaacatccagaaccgttagggaaagaagttacgaataaacaaagaatc
aaaatatctcctgtagcgaagaagattgcgaaaactgaaaatcttgatattagagcatta
cttggtacaggtccaggtggaagaattacaaaggtagatgtattaaaggcacttgaagaa
agagtagcaattccagaagtacttgaagaaagtaaagtacttcctgttactggtatgcgg
aaagcaatcgcaaatcgtatgcatgcaagcttacaaaatagtgcgcaattaacattaacg
atgaaagtagatgtgacagatttagttgctttacataaagaaatagcggaagttgtacaa
aaacgatacgataacaaattaaccattacggatttcgtttctcgagctgttgtattagcg
cttggggagcataaagaaatgaacagcgcttatatagatgatgcaattcatcaatttgaa
catgttcatttaggtatggcagtcgcattagaaaaaggattagtcgttccagctattcgc
ttcgcaaataatctctcattagtagagttatctaaagagattaagaatgcggcacaaaag
gcacgagcaggcaatttaaatagtgatgatatgcaaggaacaacatttacaattagtaat
ttaggaagcttcggtattgaatattttacacccgtattaaacacaccagaaactggtatt
ttaggtgtaggtgcaattgaacatgttcctgtatataaagggaaaaaattaaaaaaagga
agtatgttacctttaagtttaacattcgatcatcgtgtactagacggtgcaccagcagct
gcatttttacgcacaattaaacgctatttagaagaacctgtaacaattcttttataa

DBGET integrated database retrieval system