KEGG   Bacillus anthracis Sterne: BAS3722Help
Entry
BAS3722           CDS       T00184                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00230  Purine metabolism
bat01100  Metabolic pathways
Module
bat_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BAS3722 (gmk)
Enzymes [BR:bat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BAS3722 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 RsgA_GTPase MMR_HSR1 AAA_33 Rad17
Motif
Other DBs
NCBI-GeneID: 2848043
NCBI-ProteinID: YP_029973
UniProt: Q81WG7
Position
complement(3688707..3689324)
Genome map
AA seq 205 aa AA seqDB search
MRSRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVDGVDYFFKER
EEFEEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQVKKAFPEGV
FIFLAPPSLSELKNRIVGRGTETEDVIENRLTVAKEEIDMMDAYDYVVENDQVELACERI
KAIVVGEHCRRERVAKYYKEMTEGL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtagaagaggattgctcatcgttctttcaggaccttctggtgttgggaaagga
acggttcgaaaagagctgtttagtcatgaggatacacgttttcagtactccatttcagta
acgacacgtaagccacgtgaaggtgaagtggatggtgtggattatttctttaaagagaga
gaagaatttgaggaaatgattcgtaatgaaaaattacttgagtgggctgagttcgtaggt
aattattacggaacaccaattgactatgttgaaaaaacattgcaagaaggaaaagatgta
ttcttagaaattgaagtgcaaggagcaattcaagttaagaaagctttcccagaaggtgta
tttattttcttagcacctccaagtttatctgaactaaagaaccgaattgtcggtcgtggt
acagaaactgaagatgttattgaaaatcgtttaacggtagcgaaagaagaaattgatatg
atggacgcttacgactacgttgtagaaaacgaccaagttgaactagcttgtgaaagaatt
aaagcaattgtggttggtgaacattgccgccgcgaaagagtagcaaaatattataaagaa
atgacggagggtctataa

DBGET integrated database retrieval system