KEGG   Bacillus anthracis Sterne: BAS3881Help
Entry
BAS3881           CDS       T00184                                 

Definition
(RefSeq) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00010  Glycolysis / Gluconeogenesis
bat00020  Citrate cycle (TCA cycle)
bat00620  Pyruvate metabolism
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01200  Carbon metabolism
Module
bat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS3881
   00020 Citrate cycle (TCA cycle)
    BAS3881
   00620 Pyruvate metabolism
    BAS3881
Enzymes [BR:bat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAS3881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-GeneID: 2848092
NCBI-ProteinID: YP_030131
Position
complement(3829314..3830573)
Genome map
AA seq 419 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEATPAATAEVVNERVIAMPSVRK
YARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPAAAKEEAPKAQ
PIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHRKKFKAVAADK
GIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTDKGLLVPVVKD
TDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTPVINHPEVAIL
GIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLNDPQLLVMEA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgacgaagtaaacgaagacgacgtacttcttgaagtacaa
aatgataaagcagtagtagaaattccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggtacggttgcagtagttggagatacattaattaaatttgatgctccagga
tacgaaaaccttaaatttaaaggcgacgatcatgacgaagctcctaaagctgaagctact
ccagcagcaactgcagaagtagtaaatgagcgcgtaatcgctatgccatctgttcgtaaa
tatgctcgtgaaaacggcgtagacattcataaagtagctggttctggtaagaacggtcgt
atcgtaaaagctgacatcgatgcatttgcaaatggtggacaagcagtagcagcaactgag
gctccagcagcagtagaagctactccagcagcagcgaaagaagaagcaccaaaagcacaa
ccaatcccagctggtgaatatccagaaactcgtgagaaaatgagtggtatccgtaaagca
attgcgaaagcaatggttaactctaaacatacagctcctcacgtaacattaatggatgaa
gtagatgtaactgaacttgttgctcaccgtaagaagttcaaagctgtggcagctgacaaa
ggtattaaattaacttaccttccatacgttgttaaagctttaacatctgcattacgtgaa
tacccaatgttaaacacttctttagatgatgcttctcaagaagtagttcataaacattac
ttcaacatcggtatcgcagctgatacagacaaaggtctattagtaccagttgttaaagat
acagatcgcaagtctatcttcacaatttctaacgagatcaatgatcttgctggtaaagca
cgtgaaggtcgtttagctcctgctgaaatgaaaggcgcttcttgcacaattacaaacatt
ggttctgcaggtggacaatggttcactccagttatcaaccacccagaagtagcaatcctt
ggtatcggccgtatcgctgagaaaccagttgtgaaaaacggtgagatcgttgcagctcca
gtattagcattatctctaagctttgaccatcgtttaattgacggcgcaactgctcaaaaa
gcattaaaccaaattaaacgtctattgaatgacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system