KEGG   Bacillus anthracis Sterne: BAS4165Help
Entry
BAS4165           CDS       T00184                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00010  Glycolysis / Gluconeogenesis
bat00052  Galactose metabolism
bat00500  Starch and sucrose metabolism
bat00520  Amino sugar and nucleotide sugar metabolism
bat00521  Streptomycin biosynthesis
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01200  Carbon metabolism
Module
bat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bat_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS4165
   00052 Galactose metabolism
    BAS4165
   00500 Starch and sucrose metabolism
    BAS4165
   00520 Amino sugar and nucleotide sugar metabolism
    BAS4165
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAS4165
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BAS4165
Enzymes [BR:bat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BAS4165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-GeneID: 2851989
NCBI-ProteinID: YP_030414
Position
complement(4080937..4081920)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESILRSMLAEEGRITSKDVFEAHGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtgtacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagagttaggt
gaattaaaaagtaagttaatcggtattggtatgggagctcctggtcctgtacacgtggcg
tctggaatgatttatgaagcggttaacttaggatggaaaaactatccgttaaaagattta
ttagaagtagaaacaggattacctgttgttattgataatgatgcaaatttagcggcactt
ggtgaaatgtggaagggtgctggtgaaggagcaaaagatttaatttgtatgacacttggc
actggtgttggcggcggtgtaattgccaatggtgagattgtacatggcgtaagcggtgct
gctggtgagattggacacattacagtcgttacagagaatgctttcccatgtaattgcggg
aagtctggttgcctagaaactgtagcatctgcaacaggtattgtacgtgttgctatgcag
aaaatacaagagactgataaagaaagtattctacgttctatgttagcagaagaagggcgt
attacatcaaaagacgtatttgaagcacatggacaaggtgatgaactagcaggcgaagta
gtagaaaaggtagcttcttatttaggattagctgtagcgaacctttcgagcacgttgaat
ccagagaaaattgttattggtggaggcgtttctaaagctggagatgcactattagaacca
attcaacgttatttcgagcaatacgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system