KEGG   Bacillus anthracis Sterne: BAS4316Help
Entry
BAS4316           CDS       T00184                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bat  Bacillus anthracis Sterne
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAS4316 (ruvA)
Enzymes [BR:bat01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BAS4316 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4228224..4228841)
Genome map
AA seq 205 aa AA seqDB search
MFEYVTGYVEYVGPEYVVIDHNGIGYQIFTPNPYVFQRSKQEIRVYTYHYVREDIMALYG
FKTREERLLFTKLLGVSGIGPKGALAILASGQTGQVVQAIEHEDEKFLVKFPGVGKKTAR
QMILDLKGKLADVVPDAFVDLFSDEERFDEKKGSSAELDEALEALRALGYAEREVSRVVP
ELLKESLTTDQYIKKALSLLLNGKR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaatatgttacaggttacgtggagtatgtaggaccggaatatgtcgtaattgat
cataatggaattggttatcaaattttcacaccgaatccgtatgtatttcaaagaagtaag
caagaaatccgtgtctatacatatcattatgtgagagaagatattatggcactttacggg
tttaaaacacgtgaagagcgtttattatttacaaagttgttaggggtgtctggtattgga
ccaaaaggtgctcttgcaattttagcttctggtcaaacaggacaggtcgttcaagcgatt
gaacatgaagacgagaagtttttagtgaagttcccgggcgtcggaaagaaaacagcacgc
caaatgattttagatttaaaaggaaaactagcagacgttgtaccagatgcatttgttgat
ttattctcagacgaagaacgttttgatgagaagaaaggttcgtcagctgagcttgatgag
gcgctggaagctctgcgcgcacttggatacgcagaacgagaagtttctcgcgttgtacca
gagttattaaaagaatcattaacgacggatcagtatattaaaaaggcacttagtctttta
ctaaatggtaagaggtga

DBGET integrated database retrieval system