KEGG   Bacillus anthracis Sterne: BAS4420Help
Entry
BAS4420           CDS       T00184                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bat  Bacillus anthracis Sterne
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bat01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bat00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4329245..4330021)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGV
FAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggctacgttaaatcat
gcgccagctaacgcgatgtcttcgcaagttatgcatgacgttactgaattaattgatcaa
gtggagaaggatgataatattcgtgttgttgttattcatggtgaagggcgcttcttctcg
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcgactgaatta
gcgcagcttggacaagttacgtttgagcgcgttgaaaaatgttcaaaaccagttatcgcg
gcaattcatggagcggcacttggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagcgcaaaacttggtttacctgaattaacacttggattaattcctgga
tttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccgattactggtgcagaagcattaaaatggggactagttaacggagtt
tttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacagattgctggaaaa
agcccagcgacggcccgtgctgtactagagttattgcaaacgacgaaatcgtctcattat
tatgagggtgtacaacgcgaagctcaaatctttggtgaagtatttacgagtgaagatgga
agagaaggtgtagcagcatttttagaaaagcgtaagccttcatttagtggcaggtag

DBGET integrated database retrieval system