KEGG   Bacillus anthracis Sterne: BAS4493Help
Entry
BAS4493           CDS       T00184                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAS4493 (pfkA)
   01230 Biosynthesis of amino acids
    BAS4493 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS4493 (pfkA)
   00030 Pentose phosphate pathway
    BAS4493 (pfkA)
   00051 Fructose and mannose metabolism
    BAS4493 (pfkA)
   00052 Galactose metabolism
    BAS4493 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BAS4493 (pfkA)
Enzymes [BR:bat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BAS4493 (pfkA)
Protein phosphatases and associated proteins [BR:bat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BAS4493 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4408689..4409648)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEEYDMEDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGKGGRCVGIQDNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggattaatttctggtcacattgaaaaattagaactaggttctgttggcgatatt
atccaccgcggtggtacgaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggtatcgagcaattaaagaaacacggtatcgaaggacttgttgttatt
ggtggagatggttcttaccaaggcgctaaaaaattaactgaacaaggattcccttgtgtt
ggtgtaccaggtacaattgacaatgatatccctggaacagacttcacaattggtttcgat
acagctttaaacactgttattgatgcaattgataaaattcgtgacacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggtgatatcgcattatgggct
ggtttagctgatggtgcagaaacaatcttaattccagaagaagagtatgacatggaagat
gttatcgctcgtctgaagcgcggtagtgaacgtggtaaaaaacacagtattatcgttgta
gctgaaggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaaacttt
gatactcgcgtaactgtattaggtcacgtacaacgtggtggatcaccaagtgcacaagac
cgtgtattagcaagccgtcttggcgcaagagcagttgaattattaattgctggtaaaggt
ggacgttgtgtaggtattcaagataacaaacttgttgatcatgacattatcgaagcgtta
gctcaaaagcatacaatcgataaagatatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system