KEGG   Bacillus anthracis Sterne: BAS4527Help
Entry
BAS4527           CDS       T00184                                 

Definition
argininosuccinate lyase (EC:4.3.2.1)
Orthology
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
bat  Bacillus anthracis Sterne
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAS4527
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAS4527
   00330 Arginine and proline metabolism
    BAS4527
Enzymes [BR:bat01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     BAS4527
Exosome [BR:bat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAS4527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4434160..4435548)
Genome map
AA seq 462 aa AA seqDB search
MSKLWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIK
IGLQYLLEEAKQNKLHFSVEAEDIHLNIEKMLMEKIGEVGGKLHTGRSRNDQVATDMHLY
LKEKVEHIIKAIKQLQTVLVHQAENNIETIMPGYTHLQRAQPISFAHHILAYFWMLERDV
NRYEDSLKRINISPLGAGALAGTTFPIDREYSAELLGFNGIYENSLDAVSDRDFILEFLS
NSSMLMMHLSRFCEELILWSSQEFQFIEMSDQYATGSSIMPQKKNPDMAELIRGKTGRVY
GNLFSLLTVMKGLPLAYNKDLQEDKEGMFDTVKTVEGCLHIMAGMLETMTVNKEKMGQAV
TQDFSNATEIADYLANKGLPFRQAHEIVGKLVLHCTQKGIYLIDVPLATYKEMSALFEED
LYEVLSPYAAVKRRNSAGGTGFEQIEKALEKAKGLTKEAIKN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaactttggggcggacgttttacggaagaagcggaagcgtgggttgaagagttc
ggggcatccatctccttcgatcaacaattagtaaatcaagatataaacgggagtattgcg
cacgtaacgatgctagcaaagcaaggcatcgttacgaaagaagaagcagagaaaataaag
ataggtcttcaatatttattagaagaagcgaaacaaaataaattgcatttttccgttgaa
gcggaagacattcatttaaatatcgaaaagatgttaatggaaaaaatcggtgaagtagga
gggaaacttcatactggccgaagtcgtaatgatcaagtagcgacagatatgcacttatat
ttaaaagaaaaagtagagcatattataaaagctataaaacaattgcaaactgttcttgtt
catcaagcagaaaataatattgaaaccattatgcctggctatacgcacttacagcgtgcc
cagccaatttcatttgctcatcatattctcgcttacttttggatgttagagcgtgatgta
aatcgttatgaagattcattaaagcgtattaacatttcgccattaggagcaggtgcgtta
gctggaacgacattcccaattgaccgagaatatagtgcggagctccttggatttaatgga
atctatgaaaatagtttagatgcagtaagcgatcgtgatttcatactggagttcctcagt
aactcatctatgcttatgatgcacttatcacgcttttgcgaagaacttattttatggagt
agccaagagtttcaatttattgaaatgagcgatcaatacgcaactggaagcagcattatg
ccgcaaaagaaaaatccagatatggcggaacttattcgtggtaaaacaggcagagtgtac
ggtaatttatttagtttacttacagtcatgaaaggattaccgctcgcttacaataaagat
ttgcaagaagataaagaaggaatgtttgatacagtgaaaacagtagaaggctgccttcat
attatggcaggcatgttagagacaatgactgtaaacaaagaaaaaatggggcaagctgta
acgcaagatttctctaacgcaacagaaattgctgactacttagcaaacaaaggactacca
ttccgtcaagctcatgaaattgttggaaagctagtgctacactgcacacaaaaaggaatt
tatttaatagatgtaccacttgcaacatataaagaaatgagcgcgctatttgaagaagat
ttgtatgaagtgctgtcaccatatgcagctgtaaagcgtcgtaacagtgctggcgggact
gggtttgagcaaattgaaaaagctttggagaaggcgaaaggattaacgaaagaagctatt
aagaattga

DBGET integrated database retrieval system