KEGG   Bacillus anthracis Sterne: BAS4527Help
Entry
BAS4527           CDS       T00184                                 

Definition
argininosuccinate lyase (EC:4.3.2.1)
Orthology
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
bat  Bacillus anthracis Sterne
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAS4527
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAS4527
   00330 Arginine and proline metabolism
    BAS4527
Enzymes [BR:bat01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     BAS4527
Exosome [BR:bat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAS4527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4434160..4435548)
Genome map
AA seq 462 aa AA seqDB search
MSKLWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIK
IGLQYLLEEAKQNKLHFSVEAEDIHLNIEKMLMEKIGEVGGKLHTGRSRNDQVATDMHLY
LKEKVEHIIKAIKQLQTVLVHQAENNIETIMPGYTHLQRAQPISFAHHILAYFWMLERDV
NRYEDSLKRINISPLGAGALAGTTFPIDREYSAELLGFNGIYENSLDAVSDRDFILEFLS
NSSMLMMHLSRFCEELILWSSQEFQFIEMSDQYATGSSIMPQKKNPDMAELIRGKTGRVY
GNLFSLLTVMKGLPLAYNKDLQEDKEGMFDTVKTVEGCLHIMAGMLETMTVNKEKMGQAV
TQDFSNATEIADYLANKGLPFRQAHEIVGKLVLHCTQKGIYLIDVPLATYKEMSALFEED
LYEVLSPYAAVKRRNSAGGTGFEQIEKALEKAKGLTKEAIKN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaactttggggcggacgttttacggaagaagcggaagcgtgggttgaagagttc
ggggcatccatctccttcgatcaacaattagtaaatcaagatataaacgggagtattgcg
cacgtaacgatgctagcaaagcaaggcatcgttacgaaagaagaagcagagaaaataaag
ataggtcttcaatatttattagaagaagcgaaacaaaataaattgcatttttccgttgaa
gcggaagacattcatttaaatatcgaaaagatgttaatggaaaaaatcggtgaagtagga
gggaaacttcatactggccgaagtcgtaatgatcaagtagcgacagatatgcacttatat
ttaaaagaaaaagtagagcatattataaaagctataaaacaattgcaaactgttcttgtt
catcaagcagaaaataatattgaaaccattatgcctggctatacgcacttacagcgtgcc
cagccaatttcatttgctcatcatattctcgcttacttttggatgttagagcgtgatgta
aatcgttatgaagattcattaaagcgtattaacatttcgccattaggagcaggtgcgtta
gctggaacgacattcccaattgaccgagaatatagtgcggagctccttggatttaatgga
atctatgaaaatagtttagatgcagtaagcgatcgtgatttcatactggagttcctcagt
aactcatctatgcttatgatgcacttatcacgcttttgcgaagaacttattttatggagt
agccaagagtttcaatttattgaaatgagcgatcaatacgcaactggaagcagcattatg
ccgcaaaagaaaaatccagatatggcggaacttattcgtggtaaaacaggcagagtgtac
ggtaatttatttagtttacttacagtcatgaaaggattaccgctcgcttacaataaagat
ttgcaagaagataaagaaggaatgtttgatacagtgaaaacagtagaaggctgccttcat
attatggcaggcatgttagagacaatgactgtaaacaaagaaaaaatggggcaagctgta
acgcaagatttctctaacgcaacagaaattgctgactacttagcaaacaaaggactacca
ttccgtcaagctcatgaaattgttggaaagctagtgctacactgcacacaaaaaggaatt
tatttaatagatgtaccacttgcaacatataaagaaatgagcgcgctatttgaagaagat
ttgtatgaagtgctgtcaccatatgcagctgtaaagcgtcgtaacagtgctggcgggact
gggtttgagcaaattgaaaaagctttggagaaggcgaaaggattaacgaaagaagctatt
aagaattga

DBGET integrated database retrieval system