KEGG   Bacillus anthracis Sterne: BAS4654Help
Entry
BAS4654           CDS       T00184                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAS4654
Enzymes [BR:bat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BAS4654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4548156..4548974)
Genome map
AA seq 272 aa AA seqDB search
MEESRMWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNR
GHIDSFDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPC
LGVLAGPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRW
YSELIKSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFNNVKISDKAFKEWPNCY
HELLNEYERDEILNYIQSFTEIRINNIIETNK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagccgtatgtggaattatgaagctgaagaagcaaaggctgtaatcgttatc
gtgcacggcgcaatggaatatcacggacgctatgaagccgttgcggaaatgtggaatcat
atcggctaccatgtcgtgatgggggaccttccgtcacatggaacgacttcaagaaataga
ggacatattgattcgtttgatgaatacatagaggaagttaaattatgggtgaaagaggca
agaaagtatcggttacctatttttctatttggtcatagtatgggtggtcttattgtcatt
cgtatgatgcaagaaacgaagagagaagatgtagacggcattattttaagttcgccatgt
ttaggtgtattagctggaccttctgcaccgcttcaagctgcctcaaaaatattaaatatt
atcgctccgaagttacaatttgcaacgaatcttacagtggaaatgtcaacgcgtaatcat
gaagtgagagatgcgatggagaacgattcattgttcttgcgcaaagtatcagtacgttgg
tatagtgaattgattaagtctattgaaatcgctcataaaaaaatagatgattttccagat
gttccgctcttgctaatgcaagcatgtgaggataaacttgtagataaaacacgtgtccgc
acttggtttaataatgttaaaataagtgataaggcttttaaagaatggccgaattgttat
catgagttattaaatgagtatgagcgtgatgaaattttgaattatattcagtcatttact
gaaatacgcatcaataacataatagaaacaaataagtaa

DBGET integrated database retrieval system