KEGG   Bacillus anthracis Sterne: BAS4837Help
Entry
BAS4837           CDS       T00184                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAS4837
   01230 Biosynthesis of amino acids
    BAS4837
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS4837
  Energy metabolism
   00680 Methane metabolism
    BAS4837
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAS4837
Enzymes [BR:bat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAS4837
Exosome [BR:bat04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAS4837
  Exosomal proteins of melanoma cells
   BAS4837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
4724154..4724708
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERDAELTTDGKKQANTLATFLLEHHPQIDHIISSPFVRAIDSIRP
YARQANLSIQEDERLAERILSDVPMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
QHVLKLNYTTTLLVTHGNLLTLILKYFDHTIGFHEWKALTNPDVYEIVIDEQCTIKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgtcatacgacattgttcagcaactggccaagaacgtgatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattcctcttagagcaccat
ccacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcacgccaagccaatttgtctatccaagaagatgaacgattagctgaacgcatatta
agcgacgttccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggggagtcaacgaaacaagcaacggatcgtgctatatcgcttatc
caacacgttttaaaattaaactatactacaacactacttgttacacatggcaatttactt
acactcattttaaagtactttgatcatacgattggctttcatgaatggaaagctttaacg
aatcctgatgtttacgaaattgtaattgatgaacaatgtactataaaacgattatgggaa
gcatcatccaagtaa

DBGET integrated database retrieval system