KEGG   Bacillus anthracis Sterne: BAS4837Help
Entry
BAS4837           CDS       T00184                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAS4837
   01230 Biosynthesis of amino acids
    BAS4837
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS4837
  Energy metabolism
   00680 Methane metabolism
    BAS4837
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAS4837
Enzymes [BR:bat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAS4837
Exosome [BR:bat04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAS4837
  Exosomal proteins of melanoma cells
   BAS4837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4724154..4724708
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERDAELTTDGKKQANTLATFLLEHHPQIDHIISSPFVRAIDSIRP
YARQANLSIQEDERLAERILSDVPMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
QHVLKLNYTTTLLVTHGNLLTLILKYFDHTIGFHEWKALTNPDVYEIVIDEQCTIKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgtcatacgacattgttcagcaactggccaagaacgtgatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattcctcttagagcaccat
ccacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcacgccaagccaatttgtctatccaagaagatgaacgattagctgaacgcatatta
agcgacgttccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggggagtcaacgaaacaagcaacggatcgtgctatatcgcttatc
caacacgttttaaaattaaactatactacaacactacttgttacacatggcaatttactt
acactcattttaaagtactttgatcatacgattggctttcatgaatggaaagctttaacg
aatcctgatgtttacgaaattgtaattgatgaacaatgtactataaaacgattatgggaa
gcatcatccaagtaa

DBGET integrated database retrieval system