KEGG   Bacillus anthracis Sterne: BAS5137Help
Entry
BAS5137           CDS       T00184                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bat  Bacillus anthracis Sterne
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bat00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bat00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(5021201..5022505)
Genome map
AA seq 434 aa AA seqDB search
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRH
LNAEVVFENNQVTIDASKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIG
SRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKG
TTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTF
MVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPH
PGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNS
LQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEK
VEEVKEQEVSDLHA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagatcatcgtccgtggcggaaagcggttaaacggcacagtgcgtgttgagggc
gcaaaaaatgctgtattacctataatcgctgcagccctattagcgagtgatggaaagaat
gtactatctgaagtaccagttttgtctgatgtatacacaattaatgaggtattacgtcat
ttaaatgctgaagtcgtatttgaaaataaccaagtaacaatcgatgcttctaaagagcta
aacattgaagcaccatttgaatatgtacgtaaaatgcgtgcatctgttcaagtaatggga
ccattattagcacgtaacggtcgtgctcgtattgcacttcctggtggatgtgcaattggt
tcacgtccaattgaccaacatttaaaaggcttcgaagcaatgggagcaaaagtacaggtt
ggtaacggttttgttgaggcatacgttgagggagaactaaaaggagctaaaatttattta
gacttcccaagcgtgggcgcaacagaaaatattatgtctgcagctacattagcaaaaggg
acaacaatccttgaaaacgcagcgaaagaaccagaaatcgttgacttagctaacttctta
aatgcgatgggagcgaaagtacgcggagctggaactggaacgattcgtatcgaaggcgtt
gataaattatatggtgcaaaccactctattattcctgaccgtattgaagcgggaacattc
atggttgcagcagcaattactggtggagacatcttaattgaaaatgctgtacctgaacat
ttacgctcaattacagcgaaaatggaagaaatgggtgttaaaattatcgaagaaaatgaa
ggtgtacgtgttatcggcccagataagttaaaagcggttgatattaaaactatgcctcac
ccaggtttcccaacagacatgcaatcacaaatgatggcattattactacaagctgatggc
acaagtatgattacagaaacggtatttgaaaaccgctttatgcacgttgaagaattccgt
cgtatgaatgctgatattaaaatcgaaggtcgttctgttattatgaacggtccaaacagc
ttacaaggtgctgaagtaggcgcaactgatttacgtgctgcagctgcattaatcttagct
ggtttagtatcagaaggttacactcgtgtaactgagttaaagcatcttgaccgtggttat
gtagatttccataagaaattagctgcattaggtgcaactattgaacgtgtaaacgaaaaa
gtagaagaagtgaaagaacaagaagtttctgatcttcacgcttaa

DBGET integrated database retrieval system