KEGG   Bacillus anthracis Sterne: BAS5183Help
Entry
BAS5183           CDS       T00184                                 

Definition
(RefSeq) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00520  Amino sugar and nucleotide sugar metabolism
bat00550  Peptidoglycan biosynthesis
bat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAS5183
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAS5183
Enzymes [BR:bat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BAS5183
Peptidoglycan biosynthesis and degradation proteins [BR:bat01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BAS5183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-GeneID: 2853124
NCBI-ProteinID: YP_031422
UniProt: Q81JW5
Position
complement(5063148..5064437)
Genome map
AA seq 429 aa AA seqDB search
MEKLLIEGGRALNGTIRVSGAKNSAVALIPATILADTPVTIGGVPNISDVKMLGDLLEEI
GGRVTYGQEEEMVVDPSNMVAMPLPNGKVKKLRASYYLMGAMLGRFKKAVIGLPGGCHLG
PRPIDQHIKGFEALGAHVTNEQGAIYLRADELRGARIYLDVVSVGATINIMLAAVRAKGR
TVIENAAKEPEIIDVATLLTSMGARIKGAGTDVIRIDGVDSLHGCHHTIIPDRIEAGTYM
ILGAASGGEVTVDNVIPQHLESVTAKLREAGVQVETNDDQITVNGDRRLKVVDIKTLVYP
GFPTDLQQPFTTLLTKAHGTGVVTDTIYGARFKHIDELRRMNAQIKVEGRSAIVTGPVLL
QGAKVKASDLRAGAALVIAGLMADGITEVTGLEHIDRGYENIVDKLKGLGANIWREQMTK
QEIEEMKNA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattgctaattgaaggcggaagagctttaaatggaacaattcgcgtgagtggt
gcaaagaacagcgccgttgcattaattccagcgacaattttagcagatactccagtaact
attggtggtgtccctaatatttcggacgtgaaaatgttaggagacttactagaggaaatt
ggaggaagagtaacgtatggacaggaggaagagatggtagtcgatccttctaacatggtt
gcaatgcctttaccaaacggaaaagtgaaaaaattgcgtgcttcttattatttaatgggt
gcgatgcttggccgttttaaaaaagctgttattgggcttccaggtggatgtcacttagga
ccgaggccaattgatcagcatattaaagggtttgaagcgttaggtgcacatgttacgaat
gaacaaggtgctatctatttaagagcagatgaactacgcggggctcgtatttatttagat
gttgttagtgtaggagctacgattaatattatgctagcagctgtacgagcgaaaggtaga
actgttattgaaaacgcagcgaaagaaccagagattattgatgtagctacactgttaact
agcatgggagcacgtattaaaggtgctggtacagatgtaatccgaattgatggtgtggat
tcattgcacggttgtcatcatacgatcattccagatcgtattgaagcgggtacgtatatg
attttaggtgctgcatcaggaggagaagtaacagttgataatgttattcctcagcactta
gagtcagttacggcgaagctccgagaagctggtgtccaggttgaaacgaatgatgaccag
attacagtgaacggtgatagaagattaaaagtagttgatataaaaacgcttgtatatcca
ggtttcccaacagacttacaacagccgtttacaacacttttaacaaaggcgcatggaacg
ggtgttgtaacggatacgatttatggtgcacgttttaaacatattgatgaattacgtcgt
atgaatgcacaaattaaagtagaaggtcgatcagctatcgtaactggtcctgttttattg
caaggtgcaaaagtgaaagcgagtgatttgcgagctggagcagcacttgttatcgcagga
ttaatggcggatggaattacagaagtaaccggacttgagcatattgatcgaggttatgaa
aatatagtagacaagcttaaagggcttggtgcaaacatttggcgagaacaaatgacaaag
caagaaattgaagaaatgaagaacgcataa

DBGET integrated database retrieval system