KEGG   Buchnera aphidicola Tuc7 (Acyrthosiphon pisum): BUAPTUC7_094Help
Entry
BUAPTUC7_094      CDS       T00821                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bau  Buchnera aphidicola Tuc7 (Acyrthosiphon pisum)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUAPTUC7_094 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BUAPTUC7_094 (dapE)
Enzymes [BR:bau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BUAPTUC7_094 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98963..100090
Genome map
AA seq 375 aa AA seqDB search
MTCSITELAKKLISIPSVSPKDLGCQDIIIKRLCAIGFDIKRVNVNDTKNFWAFRGTGKT
LTFAGHTDVVPIGQDKDWQTDPFQPVIRSGYLFGRGSADMKGALAAMITAAERFVNKFPN
HKGRLSFLITSDEESSAVDGTIKVVEYLMSKRDMIDYCIVGEPSSTNIVGDVIKNGRRGS
ITANITIHGIQGHIAYPDLADNPIHKGLPVILKILSIKLDSGNDFFLPSSINIANIHAGN
GFNNVIPGSLFVQFNIRFSSEVSEKHIQSQIVNILNSNDINYSIEWLFSGKPFITKKGLL
IDTVIQSIFYFNKKKPILSTSGGTSDGRFIALMGSEVVELGLVNNTIHKVNECVKISDLK
LLSCMYEDIMKNLLS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacttgttctattactgaattagcaaaaaaactaatttctattccttctgttagtcca
aaagatttaggttgtcaagatattataataaaacgtttatgtgcaataggatttgacatt
aaaagagtaaatgttaatgatacaaaaaatttttgggcttttagaggtacaggtaaaaca
ttaacatttgcaggacatacagatgtagttccaataggtcaagataaagattggcaaact
gatccttttcaaccagtcatacgaagtggatatttatttggcagaggttctgctgatatg
aagggtgctttagcagcaatgattactgcggctgaaagatttgtaaataagtttccaaat
cataaaggacgtttgtcttttcttattacttcagatgaagagtctagtgcagttgatgga
acaattaaagtagtagaatatttaatgtctaaaagggatatgattgattattgtatagta
ggagaaccctctagtactaatatagtgggtgatgttataaaaaatggtcgacgtggttca
attacagctaatataactattcatggaatacaggggcatattgcatatcctgatttagca
gataatccaatacataaagggttacctgttattttaaaaatattgtctataaaattagat
tctggaaatgacttttttttacctagcagcataaatattgcaaatattcatgcaggaaat
ggatttaataatgtgattccaggatctctatttgttcaatttaatattagatttagttcc
gaagtttctgaaaaacacattcaatctcaaatagtaaatatattaaattcaaatgatatt
aattattctatagaatggttattttcaggaaaaccatttatcactaaaaaaggtttattg
atagacacagtgatacaatctattttttattttaacaaaaaaaagcctattttatctact
tctggtggcacttctgacggtcgatttattgctttaatgggttctgaagtagtagagtta
ggattagtcaataatacaattcataaagttaatgaatgtgtcaaaatatctgatttaaaa
ttattaagctgtatgtatgaagatattatgaaaaatttattatcttaa

DBGET integrated database retrieval system