KEGG   Buchnera aphidicola Tuc7 (Acyrthosiphon pisum): BUAPTUC7_099Help
Entry
BUAPTUC7_099      CDS       T00821                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bau  Buchnera aphidicola Tuc7 (Acyrthosiphon pisum)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUAPTUC7_099 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    BUAPTUC7_099 (hisD)
Enzymes [BR:bau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BUAPTUC7_099 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
105092..106399
Genome map
AA seq 435 aa AA seqDB search
MKYFKNIIFWNKLHLDEQKKILSRPILKENNFIKKTVKEIIENVRLFGNSALKKYTFLFD
KQDINTFQVSKEKISSSSFYLSKVLKDSISVAQKNITCFHKAQIPSKIDVETEVGVRCEQ
IYLPLNSIGIYIPGGTAPLFSTVLMLAIPAKISGCKKIILCSPPPISNEVLYAAHICGIH
DIYQVGGAQAIAALALGTETVPKVDKIFGPGNAYVTEAKLQVSSIFNGTEIDMLAGPSEL
LIIADNTANPDFIAADLLSQAEHGVSSQVILLTPCFELAEKVVLSINKQLNNLSRLSEIL
KTLKNSSVIIVKNLSECIEISNMYAPEHLIIQTQSPREVLNYISNASSIFLGLWSPESAG
DYASGTNHVLPTYGKSITNSSLGLCDFQKRVLVQELTAKGLMKLSNTIEILSSAEKLQAH
KNAVKIRVDFLKGKI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattttaaaaatataattttttggaacaaactacatcttgatgaacaaaaaaaa
atattatcaagacctattttaaaagaaaataacttcattaaaaagactgtaaaagaaatt
atagaaaatgttagattatttggaaattcagcattaaaaaaatatacttttttatttgat
aaacaagatataaatacatttcaagtttcaaaagaaaaaatctcttcatcttcgttttat
ttaagtaaggttctaaaagattccatttctgtcgcgcaaaaaaatattacatgttttcat
aaagctcaaattccatctaaaatagatgttgaaacagaagttggagtccgttgtgagcaa
atctatttacctctaaattctataggaatttatattcctggcggaacagctcctttattt
tcgactgtattaatgttagcgatacctgctaaaatttctggttgtaaaaaaattattctt
tgctctcctcctccgattagtaacgaggttctttatgctgctcatatttgtggaattcat
gatatttatcaagttgggggagctcaggctatagctgcactcgctttaggtactgaaacg
gtccctaaagtagataagatttttggaccaggcaatgcgtatgttacagaagcaaaatta
caagttagttcaatctttaatggaacagaaatagacatgttagcaggaccttcagaatta
ttaatcattgctgacaacactgctaatccagattttattgccgctgatttattatcacaa
gctgaacatggtgtttcttctcaagtaattttgcttacaccatgttttgaattagcagaa
aaggtagtgctttccattaataaacaactgaataatttatctagattatcagaaattttg
aaaacattaaaaaacagtagtgtcataattgtcaaaaatttatcagaatgtattgaaatc
tctaatatgtatgcacctgaacatctaattattcaaacacaatcacctagagaagtactt
aactacatctctaatgctagttctatttttcttggtttatggtctcctgaatctgccgga
gattatgcgtctgggacaaatcatgttttaccaacatatggaaaatctattacaaattcg
tctttaggattgtgtgattttcaaaaacgtgtattagttcaagaattaacagctaaagga
ctaatgaaattatctaatactattgaaattttatcttccgcagaaaaacttcaagcacat
aaaaatgctgtaaaaattcgcgtagattttttaaagggaaaaatatga

  All links  
No link information was found.   
DBGET integrated database retrieval system