KEGG   Buchnera aphidicola Tuc7 (Acyrthosiphon pisum): BUAPTUC7_274Help
Entry
BUAPTUC7_274      CDS       T00821                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bau  Buchnera aphidicola Tuc7 (Acyrthosiphon pisum)
Pathway
bau00260  Glycine, serine and threonine metabolism
bau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bau01100  Metabolic pathways
bau01110  Biosynthesis of secondary metabolites
bau01130  Biosynthesis of antibiotics
bau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUAPTUC7_274 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BUAPTUC7_274 (trpA)
Enzymes [BR:bau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BUAPTUC7_274 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG NMO
Motif
Other DBs
NCBI-ProteinID: ACL30089
UniProt: B8D7H4
Position
complement(303090..303899)
Genome map
AA seq 269 aa AA seqDB search
MNRYQETFKRLSCLKEGCFIPFVVLGDPSLETSIKIIETLIKSGADALEIGIPFSDPLAD
GPTVQKSNLRALSKNNTFFEYFKILKQLRKKNKKLPIGILIYANLVYNQGIDNFYFQCFN
SGLDSVLIADVPIEESKIFYNIANKYKINPIFICPPDADADFLYKISLYAQGFIYVLSRP
GVTGIKNNTIALPRDFINKIKKYNSVPLLQGFGISNPKQIKEAISSGLSGVICGSAIINI
IEKYLNQEKKMIKEIKKFTHLLKLSTKLE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgatatcaggaaacatttaaaagattatcttgcttgaaagaaggatgttttatc
ccttttgtagttttaggtgatccttctttagaaacatcaataaaaattattgaaacttta
ataaaaagtggtgcggatgctttagaaatcggtattccgttttcagatccattagctgat
ggaccaactgtgcaaaaatctaatttacgtgctttatctaaaaataatactttttttgaa
tattttaaaatattaaaacaattacgtaaaaaaaataaaaaattacctattggtattttg
atatatgcaaatcttgtatataatcaaggtattgataatttttattttcaatgctttaat
tctggtttagattctgtacttatagcagatgttccaattgaagaatcaaaaattttttat
aatatagcaaataaatataaaattaatcctatttttatctgccctcctgatgcagacgca
gactttttatataaaatttctttatatgcacaaggatttatttatgtattatctcgtcct
ggagtaaccgggattaaaaataatactattgcattgcctagagattttataaataaaata
aaaaaatataattctgtccctctattacaaggttttggtatttcaaatcctaaacaaata
aaagaagcaatatcatcaggcttatctggtgtaatatgtggttcagcaataataaatatt
attgaaaaatatttaaatcaagaaaaaaaaatgattaaagaaataaaaaaatttactcat
ttattaaaactttctactaaattagaataa

DBGET integrated database retrieval system