KEGG   Buchnera aphidicola Tuc7: BUAPTUC7_299Help
Entry
BUAPTUC7_299      CDS       T00821                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bau  Buchnera aphidicola Tuc7
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bau01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bau01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bau00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bau00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bau00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338685..339380
Genome map
AA seq 231 aa AA seqDB search
MKINQVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLL
KRAIHTLQYILDELNQTWLSVKKSWRLNERHYGALEGLNKDEVIEKYGQKQVLLWRRSFD
ISPPQINIKDKRFPGNDPRYSHLNIHDIPLGESLEKTAKRVIPYWNKIIYPELKNNKKIL
IVAHGNSLRALIQHLYKIDNKAILDLNIPTAQPIILDFDNEKNPIKWHYLT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaatcaagtagttttaattagacatggtcaaagcgaatggaatacattaaat
aaatttactggttggcatgatgccgaattagataaaaaaggaaaagatgaagctaaattt
gctgctatcttattaaaaaaagaaaaatttttttttgattgcgcacatacatcattatta
aaaagagcaattcatactttgcaatatattttagatgaattaaaccaaacctggttgtca
gttaaaaaatcctggcgtttaaacgaacgacattatggtgcattagaagggttaaataaa
gatgaagttattgagaaatatggacaaaaacaagttcttctatggagaagaagttttgat
attagtccacctcagattaatataaaagataaacgctttccaggaaacgatccacgctac
tctcatttaaatattcatgacatccctctaggagagagcttagaaaaaactgcaaaacga
gttattccttattggaacaaaattatttatccagaattaaaaaataataaaaaaatactt
attgtagcgcatggaaattctttacgtgccttgatacaacacttatataaaatagacaat
aaagctattttagatttaaatattcctactgcacaacccattatcttagatttcgataat
gaaaaaaatccaattaaatggcactatttaacataa

DBGET integrated database retrieval system