KEGG   Buchnera aphidicola Tuc7: BUAPTUC7_300Help
Entry
BUAPTUC7_300      CDS       T00821                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bau  Buchnera aphidicola Tuc7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bau01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bau01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bau00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bau00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bau00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:bau00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339564..340526
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVQLDRYSVSD
MINRGGTFLGSARFASFYQDKIRSIAVQNIKKRKIDALVVIGGDGSYIGAQKLTEMGIPC
ISIPGTIDNDVSGTDYTIGYFTALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEIDYKKEDLVIEIQAGIAKGKKHAIVAITEYICDVEELAQYIEKKTN
RETRATILGHIQRGGAPVVYDRILASRMGAYSVELLIKGYQGKCVGIQNEKMVFNDIKNA
LKNMKRTFKKDWLITAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattggagttttaactagtggtggcgatgctccagggatgaatgccgca
attagaggggttgttagaacagcacttagtgaaagattagaagtatttggaatttatgat
ggatatttaggtctatatgaaaaccgtatggtgcaacttgatagatatagtgtatctgac
atgattaacagaggtgggacatttttagggtcagctagatttgctagtttttatcaagac
aaaatacgctcaattgcagtgcaaaatataaaaaaaagaaaaatagatgctcttgttgtc
attggaggtgatggttcttatataggagctcaaaaattaacagaaatgggtattccatgt
attagcattccaggtactatagataatgatgtttcaggtactgattatacaataggttat
tttacagctttacaaacagtggttgaagctattgatcgattgcgcgacacttcttcttct
caccaacgtatttctattgtagaggtgatgggtagacattgtggagatttaacattagct
gcagctattgctggtggatgcgaatttattgttttaccagaaattgactataaaaaagaa
gatctagttatcgagattcaagctggcattgctaagggcaaaaaacatgctattgttgcc
ataactgaatacatttgtgatgtagaagaattagcacaatatattgaaaaaaaaactaat
cgagaaactagagcgacaattcttggacatatccaaagagggggtgcacctgtagtatat
gatcgtatattagcatcaagaatgggtgcatattcagttgaattattaataaaaggttat
cagggaaaatgtgttggaatacaaaatgaaaaaatggtttttaacgatataaaaaacgca
ctaaaaaatatgaaacgtacttttaaaaaagattggttgattactgctaaaaagttatac
taa

DBGET integrated database retrieval system