KEGG   Buchnera aphidicola Tuc7: BUAPTUC7_411Help
Entry
BUAPTUC7_411      CDS       T00821                                 

Gene name
eno
Definition
phosphopyruvate hydratase (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
bau  Buchnera aphidicola Tuc7
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bau01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bau01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bau00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bau00680]
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:bau03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454273..455577
Genome map
AA seq 434 aa AA seqDB search
MSKITKIIAREIIDSRGNPTVESEVHLEGGFVGLASSPSGASTGSLEALELRDENKDRFM
GKGVEKAVSLINEKISIALKNKNARNQSDIDHIMIDLDGTINKSKLGANAILSVSLAVAK
AAAASKRMPLYAHIAEINETPGVFSMPLPMINIINGGKHANNNIDIQEFMIQPISAKTVK
ESIRIGCEIFHALGELLKEKGMSTTVGDEGGYAPNLKSNEEALNIIQDAIQKTKYKLGQD
IRLAIDCAASELYNKNEKKYNLKGENISFSSKEFTHYLEKLSQKYPIVSIEDGQDESDWE
GFLYQTHVLGHKIQLVGDDLFVTNKNILKKGIKKGIANSILIKLNQIGTLTETLEAIKTA
KQANYGVIISHRSGETEDASIADLSVGTSSGQIKTGSMSRSDRTSKYNQLIRIEENLGTK
YAPFHGLREIKSAF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattacaaaaatcatagctcgtgaaattatagattcacgaggcaatcctact
gttgaatctgaagttcatttagaaggtggatttgtcggactagcttcttctccttccgga
gcctctaccggttctttagaagctttagaattaagggatgaaaataaagacagattcatg
gggaaaggagtggaaaaagctgtttcgttaataaacgaaaaaatatctattgcattaaaa
aataaaaatgctagaaatcaaagtgatattgatcatattatgattgatttagacggaaca
atcaataaatccaaactaggtgctaatgcgattttatctgtatctttagctgttgctaaa
gcagctgctgcatctaagagaatgcctttatatgcgcatattgcagaaataaatgagact
cctggcgttttttctatgccattgcctatgataaatattattaatggtggaaaacatgct
aataataatatagatattcaggagtttatgattcaaccaatcagcgcaaaaacagtaaaa
gaatctatacgtataggatgtgaaatatttcatgcattaggtgaattattaaaagaaaaa
ggaatgagtacaactgtaggagatgaaggaggttatgcaccaaacttgaagtctaatgaa
gaagcattaaatattattcaagatgcaatacaaaaaactaaatataaattaggacaagat
atacgattagcaatagattgtgctgcttcagaattatataataaaaacgaaaaaaaatat
aatcttaaaggagaaaatattagtttttcttcaaaggaattcactcattatttagaaaaa
ttatctcaaaaatatccgatagtttcaatcgaagatggacaagatgagtcagattgggaa
ggatttttatatcaaacacatgtactaggtcataaaatacagttagtaggagatgattta
tttgttacaaataaaaatattttaaaaaaaggtataaaaaaaggaattgcaaattcaata
ttaataaagttaaatcaaattggaacattaactgaaactctagaagcaataaaaacagca
aaacaagcaaactatggagtaattatttctcatcgttcaggtgaaacagaagacgcttct
atagcagatttatctgtaggaacatcatcaggacaaattaaaacaggttctatgagtcgt
tctgatagaacttcaaagtataatcaattgattagaattgaagaaaatttaggaacaaaa
tacgctccgtttcatggtttacgagaaattaaatcagcattttaa

DBGET integrated database retrieval system