KEGG   Buchnera aphidicola Tuc7 (Acyrthosiphon pisum): BUAPTUC7_411Help
Entry
BUAPTUC7_411      CDS       T00821                                 

Gene name
eno
Definition
phosphopyruvate hydratase (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
bau  Buchnera aphidicola Tuc7 (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUAPTUC7_411 (eno)
   01230 Biosynthesis of amino acids
    BUAPTUC7_411 (eno)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUAPTUC7_411 (eno)
  Energy metabolism
   00680 Methane metabolism
    BUAPTUC7_411 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BUAPTUC7_411 (eno)
Enzymes [BR:bau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BUAPTUC7_411 (eno)
Messenger RNA biogenesis [BR:bau03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BUAPTUC7_411 (eno)
Exosome [BR:bau04147]
 Exosomal proteins
  Proteins found in most exosomes
   BUAPTUC7_411 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454273..455577
Genome map
AA seq 434 aa AA seqDB search
MSKITKIIAREIIDSRGNPTVESEVHLEGGFVGLASSPSGASTGSLEALELRDENKDRFM
GKGVEKAVSLINEKISIALKNKNARNQSDIDHIMIDLDGTINKSKLGANAILSVSLAVAK
AAAASKRMPLYAHIAEINETPGVFSMPLPMINIINGGKHANNNIDIQEFMIQPISAKTVK
ESIRIGCEIFHALGELLKEKGMSTTVGDEGGYAPNLKSNEEALNIIQDAIQKTKYKLGQD
IRLAIDCAASELYNKNEKKYNLKGENISFSSKEFTHYLEKLSQKYPIVSIEDGQDESDWE
GFLYQTHVLGHKIQLVGDDLFVTNKNILKKGIKKGIANSILIKLNQIGTLTETLEAIKTA
KQANYGVIISHRSGETEDASIADLSVGTSSGQIKTGSMSRSDRTSKYNQLIRIEENLGTK
YAPFHGLREIKSAF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattacaaaaatcatagctcgtgaaattatagattcacgaggcaatcctact
gttgaatctgaagttcatttagaaggtggatttgtcggactagcttcttctccttccgga
gcctctaccggttctttagaagctttagaattaagggatgaaaataaagacagattcatg
gggaaaggagtggaaaaagctgtttcgttaataaacgaaaaaatatctattgcattaaaa
aataaaaatgctagaaatcaaagtgatattgatcatattatgattgatttagacggaaca
atcaataaatccaaactaggtgctaatgcgattttatctgtatctttagctgttgctaaa
gcagctgctgcatctaagagaatgcctttatatgcgcatattgcagaaataaatgagact
cctggcgttttttctatgccattgcctatgataaatattattaatggtggaaaacatgct
aataataatatagatattcaggagtttatgattcaaccaatcagcgcaaaaacagtaaaa
gaatctatacgtataggatgtgaaatatttcatgcattaggtgaattattaaaagaaaaa
ggaatgagtacaactgtaggagatgaaggaggttatgcaccaaacttgaagtctaatgaa
gaagcattaaatattattcaagatgcaatacaaaaaactaaatataaattaggacaagat
atacgattagcaatagattgtgctgcttcagaattatataataaaaacgaaaaaaaatat
aatcttaaaggagaaaatattagtttttcttcaaaggaattcactcattatttagaaaaa
ttatctcaaaaatatccgatagtttcaatcgaagatggacaagatgagtcagattgggaa
ggatttttatatcaaacacatgtactaggtcataaaatacagttagtaggagatgattta
tttgttacaaataaaaatattttaaaaaaaggtataaaaaaaggaattgcaaattcaata
ttaataaagttaaatcaaattggaacattaactgaaactctagaagcaataaaaacagca
aaacaagcaaactatggagtaattatttctcatcgttcaggtgaaacagaagacgcttct
atagcagatttatctgtaggaacatcatcaggacaaattaaaacaggttctatgagtcgt
tctgatagaacttcaaagtataatcaattgattagaattgaagaaaatttaggaacaaaa
tacgctccgtttcatggtttacgagaaattaaatcagcattttaa

DBGET integrated database retrieval system