KEGG   Buchnera aphidicola Tuc7: BUAPTUC7_449Help
Entry
BUAPTUC7_449      CDS       T00821                                 

Gene name
recD
Definition
exodeoxyribonuclease V 67 kDa polypeptide (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bau  Buchnera aphidicola Tuc7
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bau03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501998..503806
Genome map
AA seq 602 aa AA seqDB search
MLILLKKAVKLKIIRPIDFYFSQFIAQKNNIVMLVAACISYESSRGYISLPIKYFEKHYF
FSSSNEVFIKKILTLLEKKINWPVELLKHASIGNGGTSTPLVLHKKKIYLYKMWKSESNI
FNYLYTKNKKNKINQKKCSKILENLFPQKNMSFQKIAVALTLINNITFIIGGPGTGKTTT
ILKIIIALIKSSKKSIKIQLSAPTGKATTHLNEILKNNIFDLYFSEKEKCSLPSAATTIH
QLLGIQKISQKSFFNKSNCLDLDVLIIDEISMVDILMMEKILSSISKNTKLIFIGDHNQL
GPIESGSILRKICYYANDGYSFKSMISIEKLTQYKLCKKINKKTTNFISDNICVLNKNYR
FNKNSGIYTLSNAIFKKKTRIIESLFDNSIKNIFFYETNSSEQYKKMIKNICLNYEDFWE
KIYKKATMKEIIESFQNYQVLCILHDGLFGVNIINKKLEENMYKKNIIKYFYIDGEEWYI
GKPIMIINNNRALNVSNGNIGITNINKNGILQVSFLKENNTINNIPVKILRNYKTAWAIT
VHKSQGSEFMNTALILPNFNSHILNKDTLYTGITRSRKILSIFSDKKIFLNTIFKNTNKI
LF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcttattttattaaaaaaagctgtaaaattgaaaattatacgtccaattgatttttat
ttttctcaatttatcgcacaaaaaaataatattgttatgttagttgctgcttgtataagt
tatgaaagcagtagaggttatatttctctgccaattaaatattttgaaaaacattatttt
ttttctagttcaaatgaagtatttataaaaaaaatattgactcttttagaaaaaaaaata
aattggcccgttgagttattaaaacatgcatctattggtaatggtggtacttctacacct
ttagttttacataaaaaaaaaatatatctctataaaatgtggaaatctgaaagtaatatt
tttaactatttatatacaaaaaataaaaaaaataaaattaatcaaaaaaaatgctcaaaa
atattggaaaatttgtttcctcaaaaaaatatgagttttcagaaaatagcagtagcatta
actttaataaataatataacatttattattggtgggcccggaactggaaaaactactact
atattgaaaataataattgcattaataaaaagttcaaaaaaatcaataaaaattcagtta
tctgcaccgacaggaaaagcgacaacacatttaaatgaaattctaaaaaacaatatcttt
gatctgtatttttctgaaaaagaaaagtgttctctaccatctgcagctacaactatacat
caactattgggtattcaaaaaatatcacaaaaaagtttttttaataaaagtaactgctta
gatttagatgttttgattatcgatgaaatctcaatggtagacattttaatgatggaaaaa
atattatcttcaatttcaaaaaataccaagttaatttttataggagatcataatcaatta
ggtccaatagaatcaggttctattctaagaaaaatttgttattacgcaaatgatggatat
agctttaaatctatgattagtattgaaaaacttacacaatataaattgtgtaaaaaaata
aataaaaaaacaacaaactttattagtgataatatatgtgttttaaataaaaactacaga
tttaataaaaattcaggtatttatacgttgtctaatgctatttttaagaaaaaaactagg
atcattgaaagtctatttgataattcgataaaaaacatttttttttatgaaactaactct
tctgaacaatataaaaaaatgatcaaaaatatatgtttaaactatgaagatttttgggaa
aaaatatataaaaaagcgacaatgaaagaaataatagaatcttttcaaaattatcaagtt
ttgtgcatattgcatgatggtttatttggtgtgaatattataaataaaaagttagaagaa
aatatgtataaaaaaaatattataaaatatttttatattgatggagaagaatggtatata
gggaaacctattatgattattaataataatcgtgctctcaatgtatcaaatggaaatata
ggtattactaatatcaataaaaatggcattttacaagtatcttttttaaaagaaaacaat
acaattaataatattcctgtaaagatattaagaaattataaaactgcctgggctattact
gttcataaatcacaaggttcagaatttatgaatacagctttaatactacctaatttcaac
tctcatattttaaataaagacactttgtatactggtataacaagatctcgaaaaatatta
agtattttttcagataaaaaaatttttttaaatactatttttaaaaatacgaataaaata
ttattttaa

DBGET integrated database retrieval system