KEGG   Buchnera aphidicola Tuc7: BUAPTUC7_555Help
Entry
BUAPTUC7_555      CDS       T00821                                 

Gene name
cysQ
Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bau  Buchnera aphidicola Tuc7
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bau00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(594569..595366)
Genome map
AA seq 265 aa AA seqDB search
MQKINFFDTINNIWRKMLDKICQLARSAGHCIMKLYNSQKFINVSYKPDNTPITDVDYAA
NNIIKKGLSLISPQIPIISEEESYNFEICRNWNSYWLVDPLDGTKEFLKKNGEFTVNISL
IEYGVPILGVIYAPFFDVLYSAFYDNAWKEEKFGSKKKINVAQAEAPLLVISRSHPNETL
KNYLEKIKCCKIKKMGSSLKFCLIAEGTAQIYPRFGDTHIWDTAAGHAIVIAAGGKVQTW
TGGNLNYSLSSRVSFINSGFYASAL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaattaatttttttgatactattaataatatatggcgtaaaatgttagataaa
atttgtcaattagcacgttctgcaggtcattgtattatgaaactttataattctcaaaaa
tttataaatgtttcatataaaccagataacactcccatcaccgatgttgattatgcagcc
aataatatcatcaaaaaaggactttcattaatttctcctcaaattccaattatttctgaa
gaagaatcatataattttgaaatatgtcgtaattggaatagttattggttagttgatccg
ttagatggaactaaagaatttttaaaaaaaaatggtgaatttacagttaatattagttta
atcgaatacggtgtccctatacttggtgtaatatacgctcccttttttgatgttctatat
tctgctttttatgacaatgcgtggaaagaagaaaaatttggatcaaagaaaaagattaat
gttgctcaagcagaagcaccattattggtgattagccgttcacatcctaatgaaaccttg
aaaaattatttagaaaaaataaaatgttgtaaaataaaaaaaatgggttcatcactaaaa
ttttgcttaatagcagaaggaactgctcaaatttatcccagatttggtgatactcatata
tgggatactgccgctggtcatgctattgttatagcggctggtggaaaagtacaaacatgg
acgggcggcaatttaaattattcattgtcttcacgtgtttcttttattaattctggtttt
tatgcgtccgcattataa

DBGET integrated database retrieval system