KEGG   Bartonella australis: BAnh1_02850Help
Entry
BAnh1_02850       CDS       T02469                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
baus  Bartonella australis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:baus01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:baus00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
347360..348499
Genome map
AA seq 379 aa AA seqDB search
MALGSQKLEQYKRIVVKVGSALLVDPQAGLRVEWLKSLVSDVAELRQKGVEILLVSSGAI
ALGRTLLHLPKGTLKLEESQACAALGQIELAKAYSETLDRHGLRTGQILLTLFDTEERRR
YLNARATINTLLHFRAVPVINENDTVATSEIRYGDNDRLAARVATMMGSDLLILLSDVDG
LYTSSPYLDPKAEFIPFVTSITSEIEKMAGAAASGFSRGGMKTKLAAGKIANSSGTAMII
ASGKALNPLAAIDRGGRKSFFAASEKPINAWKTWISGNLDPSGTLMIDQGAVKALESGKS
LLAVGVIAVEGVFDRGDTVAIVGVDGIEVARGLVNYGKDEIVRIMGCKSKEIERVLGHGP
RSAVVHHNDMVLRYLADFT
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttggatcacaaaaacttgagcaatataaacgtattgtcgtcaaagttggttct
gcacttttggttgatccccaagcagggttgcgagttgagtggctcaagagtttggtaagt
gacgttgctgagttacgccaaaaaggagtggagattttactagtgtcttctggcgctatt
gctttagggcgaacattattacatcttcctaaggggactttaaaattggaagaaagccaa
gcgtgtgctgctttgggtcaaattgaactggctaaggcttatagtgagacacttgatcgc
cacggattaagaacaggccagattttactcacgctatttgatacggaagaacggcggcgt
tatttaaatgcgcgtgccaccattaatacgcttctgcattttagagctgtgcccgttatt
aacgaaaatgacactgtggcaacgagcgaaattcgctacggtgataacgatcgtttggca
gcgcgtgttgcgactatgatgggttcagatcttttgatacttttgtcagatgttgatggt
ctttatacgagctctccttatctagatccgaaggctgaatttatcccttttgttacatca
attacgagcgaaattgaaaaaatggcgggtgctgctgcttcagggttttcaaggggcgga
atgaagacaaagctcgctgctggaaaaatagctaattcttctgggacggctatgatcatc
gcgtcgggtaaggccttgaatcctcttgcggcaattgatcgagggggacgtaagagtttt
tttgctgccagtgaaaagccgataaatgcttggaagacttggatttcaggcaatttggat
ccatctggtaccttgatgattgatcagggggcagttaaggcgcttgaatctggaaagtca
ttattagccgtgggggttatcgcggttgagggcgtttttgatcgcggagatacggttgca
attgttggcgtagatgggattgaggtcgctcgcggccttgtaaattatggtaaggatgaa
attgtgcgcattatgggctgcaaaagtaaggaaatagaacgcgtccttgggcatgggccg
cgttctgctgtagtgcatcataatgatatggttttacgctatttggccgattttacttaa

DBGET integrated database retrieval system