KEGG   Bartonella australis: BAnh1_08400Help
Entry
BAnh1_08400       CDS       T02469                                 

Gene name
murG
Definition
(GenBank) N-acetylglucosaminyl transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
baus  Bartonella australis
Pathway
baus00550  Peptidoglycan biosynthesis
baus01100  Metabolic pathways
baus01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:baus00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAnh1_08400 (murG)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BAnh1_08400 (murG)
Enzymes [BR:baus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     BAnh1_08400 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:baus01011]
 Precursor biosynthesis
  Glycosyltransferase
   BAnh1_08400 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_trans_1_3 Glyco_transf_4 Glyco_trans_4_2 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AGF74716
UniProt: M1PDP5
Position
complement(1055138..1056274)
Genome map
AA seq 378 aa AA seqDB search
MTQKKVIVLVAGGTGGHLFPAEALSVELRQRGYDVHLATDERARRFVRHFDEKHIHIISS
ATSVRRCPFAFIKAFWSLLKGSTQSWMLFRKLRPVLIGGFGGYPTFPPLLVAILTRRLTF
IHEQNAVMGRANRMLAVGVRMIAGGLLADDSVYARKMLLTGNPVREAVLKAAEICYSPSL
GEDPFYFLVFGGSQGASFFSQIVPEAIALLDNNVRKRLRIIQQVRSETKNLVKIYNDMGV
QAEIASFFDNMAEHIARSHFILARSGASTVCEIAVIGRPALFIPYPHALDHDQAANAATL
AAMGGAQIVAEKDLNGQMLAFLLAKACREPHLLEKQALAAKKAGQPRATTLLADAVEALI
AGRSVLNIKREYFDENAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaaaaaagttattgttttggttgcgggtggtacaggcgggcatctttttccc
gcggaagcactttctgttgagttaaggcagcgtgggtatgatgttcatttagcaacagat
gaaagagctaggcgttttgtacgccattttgatgaaaagcatattcatattatttcgtca
gcgacatcggtgcgacgttgtccttttgcgttcataaaagcgttttggtctttgctgaag
gggagcacgcaatcatggatgctttttcgcaagttacgtcctgtccttattggcggattt
ggcggttatccgactttcccaccgcttttggttgctatcttaacgaggcgtttgacattt
attcatgagcaaaatgctgtgatgggtcgcgcaaatagaatgttggctgttggagtacgc
atgatagcgggtggtttattagcggatgacagtgtttacgcccgtaaaatgcttcttaca
ggtaatcctgttcgtgaagccgtcctcaaagcagcggaaatttgttattctccgtctctt
ggtgaagatccgttttattttttggtttttggcgggagtcaaggggcttcttttttttca
caaattgttcccgaagcaatcgctttacttgataataacgtgcgtaagcgcctgcgtatc
atccagcaagttcgcagtgaaactaaaaatttagtaaaaatttataacgatatgggagtg
caggcagagattgcatcttttttcgacaatatggcagaacatatcgctcgctctcacttt
attttagcgcgctctggtgcttcaactgtttgtgaaatagcggtgattggccggccggct
ttatttatcccgtatccacacgctttagatcacgatcaggcggcgaacgcagctacgctc
gctgctatgggaggagctcaaatcgtagcagaaaaagatttgaatgggcaaatgctcgct
tttctcttagcaaaagcctgtcgcgaaccacatttattagaaaaacaagcacttgctgca
aaaaaggctgggcaacctcgtgcaaccacccttcttgcagatgcagttgaagcgttgatt
gcagggcggtcggtattaaatattaaaagggagtattttgatgaaaatgccgcttaa

DBGET integrated database retrieval system